Amplimer name TNNI3Kexon23
Region of interest 206 - 389
Amplimer length 500
Amplimer sequence
CTCTCAGCACAGAACTGGGTCAAAAAAGTAAATTAAGCTAGGCAGATGTTGCCACTAGACTTTTTCCTGAAAGGAAAAGC
CAGGAGCAAGCTGAGTGAATAGAAATTAAAATATGGGAAACCTTGGAATAGAAAGTTAAATCCATATTTTATGTTATGTC
TTCACACCTGTTGGAAGTATTAAACAATTGAAATTGCCCCTCCTCCACTCAGCTGATGTCTCCTGCATCAAGTAACAGCA
GTGGGTCTCTCTCACCTTCTTCTTCTTCTGATTGCCTGGTGAACCGGGGAGGACCTGGCCGGAGTCATGTGGCAGCATTA
AGAAGTCGTTTCGAATTGGAATATGCTCTAAATGCAAGGTCCTATGCTGCTTTGTCCCAAAGGTGAGTGGTAATATAAGC
AAATCTCACAGTAAAGTCTTATTTCAGAATCTTATCAAGACAGTCAACTGATTTGATTACTATTAACAGGGTTTGATTAC
CCCCTGAAAAACTTTGAAAG
Amplimer is sense? true
Mapped portion of amplimer
(when sense)
211 - 382
Cds name TNNI3K
Cds decoded as sense? true
Start of amplimer match 2180
Cds sequence
ATGGGAAATTATAAATCTAGACCAACCCAAACTTGTACTGATGAATGGAAGAAAAAAGTCAGTGAATCATATGTTATCAC
AATAGAAAGATTAGAAGATGACCTGCAGATCAAGGAAAAAGAACTGACAGAACTAAGGAATATATTTGGCTCTGATGAAG
CCTTCAGTAAAGTCAATTTAAATTACCGCACTGAAAATGGGCTGTCTCTACTTCATTTATGTTGCATTTGTGGAGGCAAG
AAATCACATATTCGAACTCTTATGTTGAAAGGGCTCCGCCCATCTCGACTGACAAGAAATGGATTTACAGCCTTGCATTT
AGCAGTTTACAAGGATAATGCAGAATTGATCACTTCTCTGCTTCACAGTGGAGCTGATATACAGCAGGTTGGATACGGTG
GCCTCACTGCCCTCCATATTGCTACAATAGCTGGCCACCTAGAGGCTGCTGATGTGCTGTTGCAACATGGAGCTAATGTC
AATATTCAAGATGCAGTTTTTTTCACTCCATTGCATATTGCAGCGTACTATGGACATGAACAGGTAACTCGCCTTCTTTT
GAAATTTGGTGCTGATGTAAATGTAAGTGGTGAAGTTGGAGATAGACCCCTCCACCTAGCATCTGCAAAAGGATTCTTGA
ATATTGCAAAACTCTTGATGGAAGAAGGCAGCAAAGCAGATGTGAATGCTCAAGATAATGAAGACCATGTCCCACTCCAT
TTCTGTTCTCGATTTGGACACCATGATATAGTTAAGTATCTGCTGCAAAGTGATTTGGAAGTTCAACCTCATGTTGTTAA
TATCTATGGAGATACCCCCTTACACCTGGCATGCTACAATGGCAAATTTGAAGTTGCCAAGGAAATCATCCAAATATCAG
GAACAGAAAGTCTGACTAAGGAAAACATCTTCAGTGAAACAGCTTTTCATAGTGCTTGTACCTATGGCAAGAGCATTGAC
CTAGTCAAATTTCTTCTTGATCAGAATGTCATAAACATCAACCACCAAGGAAGGGATGGGCACACTGGATTACACTCTGC
TTGCTACCACGGTCACATTCGCCTGGTTCAGTTCTTACTGGATAATGGAGCTGATATGAATCTAGTGGCTTGTGATCCCA
GCAGGTCTAGTGGTGAAAAAGATGAGCAGACATGTTTGATGTGGGCTTATGAAAAAGGGCATGATGCCATTGTCACACTC
CTGAAGCATTATAAGAGACCACAAGATGAATTGCCCTGTAATGAATATTCTCAGCCTGGAGGAGATGGCTCCTATGTGTC
TGTTCCATCACCCTTGGGGAAGATTAAAAGCATGACAAAAGAGAAGGCAGATATTCTCCTCCTAAGAGCTGGATTGCCTT
CACATTTCCATCTTCAGCTCTCAGAAATTGAGTTCCATGAGATTATTGGCTCAGGTTCTTTTGGGAAAGTATATAAAGGA
CGATGCAGAAATAAAATAGTGGCTATAAAACGTTATCGAGCCAATACCTACTGCTCCAAGTCAGATGTGGATATGTTTTG
CCGAGAGGTGTCCATTCTCTGCCAGCTCAATCATCCCTGCGTAATTCAGTTTGTGGGTGCTTGCTTGAATGATCCCAGCC
AGTTTGCCATTGTCACTCAATACATATCAGGGGGTTCTCTGTTCTCCCTCCTTCATGAGCAGAAGAGGATTCTTGATTTG
CAGTCTAAATTAATTATTGCAGTAGATGTTGCCAAAGGCATGGAGTACCTTCACAACCTGACACAGCCAATTATACATCG
TGACTTGAACAGTCACAATATTCTTCTCTATGAGGATGGGCATGCTGTGGTGGCAGATTTTGGAGAATCAAGATTTCTAC
AGTCTCTGGATGAAGACAACATGACAAAACAACCTGGGAACCTCCGTTGGATGGCTCCTGAGGTGTTCACGCAGTGCACT
CGGTACACCATCAAAGCAGATGTCTTCAGCTATGCTCTGTGTCTGTGGGAAATTCTCACTGGCGAAATTCCATTCGCTCA
TCTCAAGCCAGCGGCTGCGGCAGCAGACATGGCTTACCACCACATCAGACCTCCCATTGGCTATTCCATTCCCAAGCCCA
TATCATCTCTGCTGATACGAGGGTGGAACGCATGTCCTGAAGGAAGACCCGAATTTTCTGAAGTTGTCATGAAGTTAGAA
GAGTGTCTCTGCAACATTGAGCTGATGTCTCCTGCATCAAGTAACAGCAGTGGGTCTCTCTCACCTTCTTCTTCTTCTGA
TTGCCTGGTGAACCGGGGAGGACCTGGCCGGAGTCATGTGGCAGCATTAAGAAGTCGTTTCGAATTGGAATATGCTCTAA
ATGCAAGGTCCTATGCTGCTTTGTCCCAAAGTGCTGGACAATATTCCTCTCAAGGTCTGTCTTTGGAGGAGATGAAAAGA
AGTCTTCAATACACACCCATTGACAAATATGGCTATGTATCCGATCCCATGAGCTCAATGCATTTTCATTCTTGCCGAAA
TAGTAGCAGCTTTGAGGACAGCAGCTGA
Protein sequence
MGNYKSRPTQTCTDEWKKKVSESYVITIERLEDDLQIKEKELTELRNIFGSDEAFSKVNLNYRTENGLSLLHLCCICGGK
KSHIRTLMLKGLRPSRLTRNGFTALHLAVYKDNAELITSLLHSGADIQQVGYGGLTALHIATIAGHLEAADVLLQHGANV
NIQDAVFFTPLHIAAYYGHEQVTRLLLKFGADVNVSGEVGDRPLHLASAKGFLNIAKLLMEEGSKADVNAQDNEDHVPLH
FCSRFGHHDIVKYLLQSDLEVQPHVVNIYGDTPLHLACYNGKFEVAKEIIQISGTESLTKENIFSETAFHSACTYGKSID
LVKFLLDQNVININHQGRDGHTGLHSACYHGHIRLVQFLLDNGADMNLVACDPSRSSGEKDEQTCLMWAYEKGHDAIVTL
LKHYKRPQDELPCNEYSQPGGDGSYVSVPSPLGKIKSMTKEKADILLLRAGLPSHFHLQLSEIEFHEIIGSGSFGKVYKG
RCRNKIVAIKRYRANTYCSKSDVDMFCREVSILCQLNHPCVIQFVGACLNDPSQFAIVTQYISGGSLFSLLHEQKRILDL
QSKLIIAVDVAKGMEYLHNLTQPIIHRDLNSHNILLYEDGHAVVADFGESRFLQSLDEDNMTKQPGNLRWMAPEVFTQCT
RYTIKADVFSYALCLWEILTGEIPFAHLKPAAAAADMAYHHIRPPIGYSIPKPISSLLIRGWNACPEGRPEFSEVVMKLE
ECLCNIELMSPASSNSSGSLSPSSSSDCLVNRGGPGRSHVAALRSRFELEYALNARSYAALSQSAGQYSSQGLSLEEMKR
SLQYTPIDKYGYVSDPMSSMHFHSCRNSSSFEDSS*