Amplimer name INSRRexon3
Region of interest 115 - 413
Amplimer length 488
Amplimer sequence
CTCGCACTTGTGGCAGAATATGCTAGCAGGAGCAAGCAGATGTCCTGAGCCTTGGACCAGTTTGGGCCTCCTCAGGCCTC
CTCACTGCTCCCAGGGTGCCCCCCACCCTCCCTACACTCACCTGCTGCTATTACGGGTGAAGCCAGAAGGGCACTGGGCC
AGGCAACTGCCCTGGTGTATGCCGAAGGTGGAGGCACGGCCGGGCACAGAGTGCAGGCTGGCACAGCGCTCAGCTGTGAC
ACAGCGCCAGGACTCATACTGGTAGGTGCCTGGCGGGCAGGCCCACAGGCAGGCACCCTGGAAGTAGAGGTGGCGGCAAG
CTACACAGGCACGAGGGTCTTCTGGCTGGCTGCAGCCCCCCAGGCATTCGGTGTGGCAGCACTCGCCCCTCGCTGTGCAA
GCCATCCCATGGGGGCAGGGGCACACTGTGGGGAGAGTGGTGTGTTAGACGTTGGCCATGCCCCCTCAGTCCTGGCTGTC
CTTCCAAT
Amplimer is sense? false
Mapped portion of amplimer
(when sense)
62 - 367
Cds name INSRR
Cds decoded as sense? true
Start of amplimer match 636
Cds sequence
ATGGCAGTGCCTAGTCTGTGGCCCTGGGGAGCATGCCTGCCTGTGATCTTCCTCTCCTTGGGATTTGGCCTGGATACAGT
AGAGGTGTGCCCCAGCCTGGATATTCGCTCAGAGGTGGCAGAGCTTCGTCAGCTGGAGAACTGCAGCGTGGTGGAGGGCC
ACCTGCAGATCCTGCTCATGTTCACAGCCACCGGGGAGGACTTCCGCGGCCTCAGCTTCCCTCGCCTCACCCAGGTCACC
GACTACCTGCTGCTCTTCCGTGTCTACGGACTGGAGAGCCTGCGCGACCTCTTCCCCAACCTAGCAGTCATCCGCGGGAC
GCGCCTCTTCCTGGGCTATGCACTGGTCATCTTTGAGATGCCACATCTGCGTGACGTGGCACTGCCTGCACTTGGGGCCG
TGCTGCGTGGGGCTGTGCGTGTGGAGAAGAACCAGGAGCTCTGCCACCTCTCCACCATTGACTGGGGACTGCTGCAGCCA
GCACCTGGCGCCAACCACATCGTGGGCAACAAGCTGGGCGAGGAGTGTGCTGACGTGTGCCCTGGTGTGCTGGGTGCTGC
TGGTGAGCCCTGTGCCAAGACCACCTTCAGCGGGCACACTGACTACAGATGCTGGACCTCCAGCCACTGCCAGAGAGTGT
GCCCCTGCCCCCATGGGATGGCTTGCACAGCGAGGGGCGAGTGCTGCCACACCGAATGCCTGGGGGGCTGCAGCCAGCCA
GAAGACCCTCGTGCCTGTGTAGCTTGCCGCCACCTCTACTTCCAGGGTGCCTGCCTGTGGGCCTGCCCGCCAGGCACCTA
CCAGTATGAGTCCTGGCGCTGTGTCACAGCTGAGCGCTGTGCCAGCCTGCACTCTGTGCCCGGCCGTGCCTCCACCTTCG
GCATACACCAGGGCAGTTGCCTGGCCCAGTGCCCTTCTGGCTTCACCCGTAATAGCAGCAGCATATTCTGCCACAAGTGC
GAGGGGCTGTGCCCTAAAGAGTGCAAGGTAGGCACCAAGACCATCGACTCCATCCAGGCGGCACAGGATCTTGTGGGCTG
CACGCATGTGGAGGGAAGCCTCATCCTCAACCTTCGCCAGGGCTACAACCTGGAGCCACAGCTGCAGCACAGCCTGGGGC
TGGTAGAAACCATTACTGGCTTCCTCAAAATCAAGCACTCCTTTGCCCTCGTGTCCCTGGGCTTTTTCAAGAACCTCAAA
CTAATCCGGGGAGACGCCATGGTGGATGGGAACTACACTCTCTACGTGCTGGACAACCAGAACCTACAACAGCTAGGGTC
CTGGGTGGCCGCGGGGCTCACCATTCCCGTGGGCAAGATCTACTTCGCCTTCAACCCGCGCCTCTGCTTGGAACACATCT
ACCGACTGGAGGAGGTGACAGGCACGCGAGGTCGGCAGAACAAGGCTGAGATCAACCCCCGCACCAACGGAGACCGCGCC
GCCTGCCAGACTCGCACCCTGCGCTTCGTGTCCAACGTGACGGAGGCAGACCGCATCCTGCTACGCTGGGAGCGCTATGA
GCCACTGGAGGCCCGCGACCTGCTCAGCTTCATCGTGTACTACAAGGAGTCCCCATTCCAGAACGCCACAGAGCACGTGG
GTCCAGATGCTTGTGGAACCCAGAGCTGGAACCTGCTGGATGTGGAGCTGCCCCTAAGCCGCACCCAGGAGCCAGGGGTG
ACCCTAGCCTCCCTCAAGCCTTGGACACAGTACGCAGTGTTTGTGCGGGCCATCACGCTAACCACTGAGGAGGACAGCCC
TCATCAAGGAGCCCAGAGTCCCATCGTCTACCTCCGAACGCTGCCTGCAGCTCCCACGGTGCCCCAAGACGTCATCTCCA
CGTCCAACTCCTCCTCCCACCTCCTGGTGCGCTGGAAGCCACCGACCCAGCGCAATGGGAACCTCACCTACTACCTGGTG
CTGTGGCAGCGGCTGGCAGAGGACGGCGACCTCTACCTCAATGACTACTGCCACCGCGGCTTGCGGCTGCCCACCAGCAA
CAACGATCCGCGCTTCGACGGCGAAGACGGGGATCCTGAGGCCGAGATGGAGTCCGACTGCTGCCCTTGCCAGCACCCAC
CTCCTGGTCAGGTTCTGCCCCCGCTGGAGGCGCAAGAGGCCTCGTTCCAGAAGAAGTTTGAAAACTTTCTACACAACGCG
ATCACCATCCCCATATCCCCTTGGAAGGTGACGTCCATCAACAAGAGCCCCCAAAGGGACTCAGGGCGGCACCGCCGGGC
AGCTGGGCCCCTCCGGCTGGGGGGCAACAGCTCGGATTTCGAGATCCAGGAGGACAAGGTGCCCCGTGAGCGAGCGGTGC
TGAGCGGCCTGCGCCACTTCACGGAATACCGGATCGACATCCATGCCTGCAACCACGCGGCGCACACCGTGGGCTGCAGC
GCCGCCACCTTCGTCTTTGCGCGCACCATGCCCCACAGAGAGGCTGATGGTATTCCAGGAAAGGTGGCCTGGGAGGCCTC
CAGCAAGAACAGTGTCCTTCTGCGCTGGCTCGAGCCACCAGACCCCAACGGACTCATCCTCAAGTACGAAATCAAGTACC
GCCGCTTGGGAGAGGAGGCCACAGTGCTGTGTGTGTCCCGTCTTCGATATGCGAAGTTTGGGGGAGTCCACCTGGCCCTG
CTGCCCCCTGGAAACTACTCTGCCAGGGTTAGGGCAACCTCACTGGCTGGCAATGGCTCTTGGACAGACAGTGTTGCCTT
CTACATCCTTGGCCCAGAGGAGGAGGATGCTGGGGGGCTGCATGTCCTCCTCACTGCCACCCCTGTGGGGCTCACGCTGC
TCATCGTTCTTGCTGCCCTTGGTTTCTTCTACGGCAAGAAGAGAAACAGAACCCTGTATGCTTCTGTGAATCCAGAGTAC
TTCAGCGCCTCTGATATGTATGTCCCTGATGAATGGGAGGTGCCTCGGGAGCAGATCTCGATAATCCGGGAACTGGGCCA
GGGCTCTTTTGGGATGGTATATGAGGGGCTGGCACGAGGACTTGAGGCTGGAGAGGAGTCCACACCCGTGGCCCTGAAGA
CGGTGAATGAGCTGGCCAGCCCACGGGAATGCATTGAGTTCCTCAAGGAAGCTTCTGTCATGAAAGCCTTCAAGTGTCAC
CATGTGGTGCGTCTCCTGGGTGTGGTATCTCAGGGCCAGCCAACTCTGGTCATCATGGAGTTAATGACCCGTGGGGACCT
CAAGAGCCATCTTCGATCTTTGCGGCCTGAGGCAGAGAACAACCCTGGGCTCCCACAGCCAGCATTGGGGGAAATGATCC
AAATGGCTGGTGAGATTGCAGACGGCATGGCCTACCTTGCTGCCAACAAGTTTGTGCACCGAGATCTAGCAGCCCGCAAC
TGCATGGTGTCCCAGGACTTCACCGTCAAGATCGGGGACTTCGGGATGACTCGGGACGTGTATGAGACAGACTATTACCG
CAAGGGTGGGAAGGGGCTGCTGCCCGTGCGCTGGATGGCCCCCGAGTCCCTCAAAGATGGGATCTTCACCACCCACTCGG
ATGTCTGGTCCTTTGGCGTGGTACTCTGGGAGATTGTGACCCTGGCAGAACAACCCTACCAGGGCCTGTCCAATGAGCAG
GTGCTGAAGTTCGTCATGGATGGCGGGGTCCTGGAGGAGCTGGAGGGCTGTCCCCTTCAGCTGCAGGAGCTGATGAGCCG
CTGCTGGCAGCCGAACCCACGCCTGCGCCCATCTTTCACACACATTCTGGACAGCATACAGGAGGAGCTGCGGCCCTCCT
TCCGCCTCCTCTCCTTCTACTACAGCCCGGAATGCCGGGGGGCCCGGGGCTCCCTGCCTACCACCGATGCAGAGCCTGAC
TCCTCACCCACTCCAAGAGACTGCAGCCCTCAAAATGGGGGTCCAGGGCACTGA
Protein sequence
MAVPSLWPWGACLPVIFLSLGFGLDTVEVCPSLDIRSEVAELRQLENCSVVEGHLQILLMFTATGEDFRGLSFPRLTQVT
DYLLLFRVYGLESLRDLFPNLAVIRGTRLFLGYALVIFEMPHLRDVALPALGAVLRGAVRVEKNQELCHLSTIDWGLLQP
APGANHIVGNKLGEECADVCPGVLGAAGEPCAKTTFSGHTDYRCWTSSHCQRVCPCPHGMACTARGECCHTECLGGCSQP
EDPRACVACRHLYFQGACLWACPPGTYQYESWRCVTAERCASLHSVPGRASTFGIHQGSCLAQCPSGFTRNSSSIFCHKC
EGLCPKECKVGTKTIDSIQAAQDLVGCTHVEGSLILNLRQGYNLEPQLQHSLGLVETITGFLKIKHSFALVSLGFFKNLK
LIRGDAMVDGNYTLYVLDNQNLQQLGSWVAAGLTIPVGKIYFAFNPRLCLEHIYRLEEVTGTRGRQNKAEINPRTNGDRA
ACQTRTLRFVSNVTEADRILLRWERYEPLEARDLLSFIVYYKESPFQNATEHVGPDACGTQSWNLLDVELPLSRTQEPGV
TLASLKPWTQYAVFVRAITLTTEEDSPHQGAQSPIVYLRTLPAAPTVPQDVISTSNSSSHLLVRWKPPTQRNGNLTYYLV
LWQRLAEDGDLYLNDYCHRGLRLPTSNNDPRFDGEDGDPEAEMESDCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNA
ITIPISPWKVTSINKSPQRDSGRHRRAAGPLRLGGNSSDFEIQEDKVPRERAVLSGLRHFTEYRIDIHACNHAAHTVGCS
AATFVFARTMPHREADGIPGKVAWEASSKNSVLLRWLEPPDPNGLILKYEIKYRRLGEEATVLCVSRLRYAKFGGVHLAL
LPPGNYSARVRATSLAGNGSWTDSVAFYILGPEEEDAGGLHVLLTATPVGLTLLIVLAALGFFYGKKRNRTLYASVNPEY
FSASDMYVPDEWEVPREQISIIRELGQGSFGMVYEGLARGLEAGEESTPVALKTVNELASPRECIEFLKEASVMKAFKCH
HVVRLLGVVSQGQPTLVIMELMTRGDLKSHLRSLRPEAENNPGLPQPALGEMIQMAGEIADGMAYLAANKFVHRDLAARN
CMVSQDFTVKIGDFGMTRDVYETDYYRKGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQ
VLKFVMDGGVLEELEGCPLQLQELMSRCWQPNPRLRPSFTHILDSIQEELRPSFRLLSFYYSPECRGARGSLPTTDAEPD
SSPTPRDCSPQNGGPGH*