FT CDS 1..1188 FT /locus_tag="BPSS0001" FT /class="0.0.0" FT /note="No significant database matches" FT /product="hypothetical protein" FT /colour=8 FT CDS complement(1282..2325) FT /note="Similar to Ralstonia solanacearum probable FT integrase/recombinase protein rsp1102 or rs02608 FT SWALL:Q8XQW6 (EMBL:AL646082) (323 aa) fasta scores: E(): FT 4.8e-34, 37.89% id in 314 aa, and to parts of Rhizobium FT loti integrase/recombinase mll6042 and mll5956 FT SWALL:Q981F2 (EMBL:AP003008) (332 aa) fasta scores: E(): FT 3e-06, 29.65% id in 172 aa" FT /locus_tag="BPSS0002" FT /class="5.1.2" FT /colour=12 FT /product="putative integrase" FT misc_feature complement(1354..1899) FT /note="Pfam match to entry PF00589 Phage_integrase, Phage FT integrase family , score -12.1, E-value 0.0013" FT /colour=9 FT CDS complement(2471..2917) FT /locus_tag="BPSS0003" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS complement(2946..3554) FT /note="Similar to Ralstonia solanacearum putative FT transcription regulator protein rsp0962 or rs02293 FT SWALL:Q8XR97 (EMBL:AL646082) (182 aa) fasta scores: E(): FT 3.2e-31, 53.33% id in 180 aa, and to Streptomyces FT coelicolor putative transcriptional regulatory protein FT sco1312 or scbac36f5.23C SWALL:Q93IV8 (EMBL:AL592292) (201 FT aa) fasta scores: E(): 2.2e-11, 30.11% id in 176 aa. Note: FT This CDS is longer in its N-terminal region than most of FT its database matches" FT /locus_tag="BPSS0004" FT /class="6.3.0" FT /colour=9 FT /product="putative DNA-binding protein" FT misc_feature complement(2982..3005) FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT misc_feature complement(3306..3470) FT /note="Pfam match to entry PF01381 HTH_3, Helix-turn-helix FT , score 66.0, E-value 5.3e-17" FT /colour=9 FT misc_feature complement(3378..3443) FT /note="Predicted helix-turn-helix motif with score FT 1501.000, SD 4.30 at aa 38-59, sequence FT LTLDDLSRAAGVSKSMLSEIER" FT /colour=2 FT CDS 3722..4921 FT /note="Similar to Escherichia coli, and Escherichia coli FT O157:H7 2-amino-3-ketobutyrate coenzyme A ligase Kbl or FT b3617 or z5044 or ecs4495 SWALL:KBL_ECOLI (SWALL:P07912) FT (398 aa) fasta scores: E(): 9.6e-104, 69.67% id in 399 aa, FT and to Salmonella typhimurium 2-amino-3-ketobutyrate FT coenzyme A ligase Kbl or stm3709 SWALL:KBL_SALTY FT (SWALL:P37419) (398 aa) fasta scores: E(): 5.5e-104, FT 69.92% id in 399 aa" FT /product="2-amino-3-ketobutyrate coenzyme A ligase" FT /EC_number="2.3.1.29" FT /gene="kbl" FT /locus_tag="BPSS0005" FT /class="3.4.2" FT /colour=6 FT misc_feature 3941..4891 FT /note="Pfam match to entry PF00155 aminotran_1_2, FT Aminotransferase class I and II , score 202.1, E-value FT 5.7e-58" FT /colour=9 FT misc_feature 4442..4471 FT /colour=8 FT /note="PS00599 Aminotransferases class-II FT pyridoxal-phosphate attachment site." FT misc_feature 4883..4906 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT CDS 4934..5965 FT /note="Similar to Escherichia coli threonine FT 3-dehydrogenase Tdh or b3616 SWALL:TDH_ECOLI FT (SWALL:P07913) (341 aa) fasta scores: E(): 5.1e-106, FT 77.05% id in 340 aa, and to Salmonella typhimurium FT threonine 3-dehydrogenase stm3708 SWALL:Q8ZL52 FT (EMBL:AE008872) (341 aa) fasta scores: E(): 2.2e-106, FT 77.64% id in 340 aa" FT /product="threonine 3-dehydrogenase" FT /EC_number="1.1.1.103" FT /gene="tdh" FT /locus_tag="BPSS0006" FT /class="3.4.2" FT /colour=6 FT misc_feature 4952..5953 FT /note="Pfam match to entry PF00107 adh_zinc, Zinc-binding FT dehydrogenase , score 336.5, E-value 2e-98" FT /colour=9 FT misc_feature 5117..5161 FT /colour=8 FT /note="PS00059 Zinc-containing alcohol dehydrogenases FT signature." FT CDS complement(6300..6953) FT /note="Similar to Caulobacter crescentus hypothetical FT protein cc3392 SWALL:Q9A314 (EMBL:AE005999) (213 aa) fasta FT scores: E(): 9.6e-20, 36.76% id in 204 aa, and to Xylella FT fastidiosa hypothetical protein xf1840 SWALL:Q9PCE1 FT (EMBL:AE004005) (237 aa) fasta scores: E(): 3e-19, 33.99% FT id in 203 aa" FT /locus_tag="BPSS0007" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS 7043..7660 FT /note="Similar to Anabaena sp. transcriptional regulator FT all7523 SWALL:Q8ZSI7 (EMBL:AP003602) (190 aa) fasta FT scores: E(): 1.8e-19, 35.26% id in 190 aa, and to FT Pseudomonas aeruginosa probable transcriptional regulator FT pa3034 SWALL:Q9HZH4 (EMBL:AE004728) (185 aa) fasta scores: FT E(): 5.7e-19, 41.53% id in 183 aa" FT /locus_tag="BPSS0008" FT /class="6.3.8" FT /colour=9 FT /product="putative TetR-family regulatory protein" FT misc_feature 7091..7231 FT /note="Pfam match to entry PF00440 tetR, Bacterial FT regulatory proteins, tetR family , score 58.8, E-value FT 7.6e-15" FT /colour=9 FT misc_feature 7274..7297 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT CDS 7761..8240 FT /note="Similar to Agrobacterium tumefaciens hypothetical FT protein atu5387 or agr_pat_559 SWALL:Q8UJT8 FT (EMBL:AE008960) (154 aa) fasta scores: E(): 9.4e-52, FT 76.31% id in 152 aa, and to Pseudomonas aeruginosa FT hypothetical protein pa5395 SWALL:Q9HTG9 (EMBL:AE004952) FT (156 aa) fasta scores: E(): 6.3e-51, 74.19% id in 155 aa" FT /locus_tag="BPSS0009" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS complement(8455..9471) FT /locus_tag="BPSS0010" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS complement(9774..10859) FT /note="Similar to Escherichia coli probable tartrate FT dehydrogenase YeaU or b1800 SWALL:TTUC_ECOLI FT (SWALL:P76251) (361 aa) fasta scores: E(): 2.2e-106, FT 70.95% id in 358 aa, and to Ralstonia solanacearum FT probable tartrate dehydrogenase oxidoreductase protein FT TtuC or rsp1612 or rs02169 SWALL:Q8XPM6 (EMBL:AL646086) FT (361 aa) fasta scores: E(): 5.3e-113, 75% id in 360 aa" FT /product="putative tartrate dehydrogenase" FT /EC_number="1.1.1.93" FT /locus_tag="BPSS0011" FT /class="3.3.5" FT /colour=7 FT misc_feature complement(9795..10841) FT /note="Pfam match to entry PF00180 isodh, FT Isocitrate/isopropylmalate dehydrogenase , score 337.8, FT E-value 7.8e-99" FT /colour=9 FT misc_feature complement(10071..10130) FT /colour=8 FT /note="PS00470 Isocitrate and isopropylmalate FT dehydrogenases signature." FT CDS 11028..11945 FT /note="Similar to Escherichia coli hypothetical FT transcriptional regulator YeaT or b1799 SWALL:YEAT_ECOLI FT (SWALL:P76250) (307 aa) fasta scores: E(): 3.4e-70, 60.13% FT id in 296 aa, and to Yersinia pestis putativellysr-family FT transcriptional regulatory protein ypo2497 SWALL:Q8ZDQ9 FT (EMBL:AJ414152) (313 aa) fasta scores: E(): 3.7e-67, FT 56.31% id in 309 aa" FT /locus_tag="BPSS0012" FT /class="6.3.6" FT /colour=9 FT /product="putative LysR-family regulatory protein" FT misc_feature 11028..11105 FT /note="Signal peptide predicted for BPSS0012 by SignalP FT 2.0 HMM (Signal peptide probability 0.835) with cleavage FT site probability 0.740 between residues 26 and 27" FT /colour=3 FT misc_feature 11046..11225 FT /note="Pfam match to entry PF00126 HTH_1, Bacterial FT regulatory helix-turn-helix protein, lysR family , score FT 78.7, E-value 7.7e-21" FT /colour=9 FT misc_feature 11085..11150 FT /note="Predicted helix-turn-helix motif with score FT 1138.000, SD 3.06 at aa 20-41, sequence FT ASFSAAAEQLAVSPAYVSKRVA" FT /colour=2 FT misc_feature 11295..11915 FT /note="Pfam match to entry PF03466 LysR_substrate, LysR FT substrate binding domain , score 156.7, E-value 2.5e-44" FT /colour=9 FT CDS 12536..13213 FT /note="Similar to Methanosarcina acetivorans hypothetical FT protein ma2467 SWALL:Q8TN26 (EMBL:AE010940) (237 aa) fasta FT scores: E(): 2.4e-28, 35.37% id in 229 aa, and to FT Rhizobium loti hypothetical protein mll0909 SWALL:Q98LR8 FT (EMBL:AP002996) (244 aa) fasta scores: E(): 9.6e-21, 31.6% FT id in 212 aa" FT /locus_tag="BPSS0013" FT /class="4.1.1" FT /colour=3 FT /product="putative membrane protein" FT misc_feature order(12572..12625,12638..12697,12758..12826,12869..12937,12998..13057,13070..13123) FT /colour=0 FT /note="6 probable transmembrane helices predicted for FT BPSS0013 by TMHMM2.0 at aa 13-30, 35-54, 75-97, 112-134, FT 155-174 and 179-196" FT CDS 13448..14071 FT /note="Similar to Escherichia coli, and Escherichia coli FT O6 hypothetical GST-like protein YliJ or b0838 or c0923 FT SWALL:YLIJ_ECOLI (SWALL:P75805) (208 aa) fasta scores: FT E(): 8.4e-22, 38.38% id in 198 aa, and to Xanthomonas FT axonopodis glutathione S-transferase xac4352 FT SWALL:AAM39182 (EMBL:AE012089) (206 aa) fasta scores: E(): FT 4.8e-42, 57.07% id in 198 aa" FT /locus_tag="BPSS0014" FT /class="7.0.0" FT /colour=13 FT /product="putative glutathione S-transferase like protein" FT misc_feature 13451..13672 FT /note="Pfam match to entry PF02798 GST_N, Glutathione FT S-transferase, N-terminal domain , score 66.8, E-value FT 3e-17" FT /colour=9 FT misc_feature 13697..14035 FT /note="Pfam match to entry PF00043 GST_C, Glutathione FT S-transferase, C-terminal domain , score 26.9, E-value FT 3e-05" FT /colour=9 FT CDS complement(14506..14970) FT /locus_tag="BPSS0015" FT /class="4.1.1" FT /colour=3 FT /note="No significant database matches" FT /product="putative membrane protein" FT misc_feature complement(order(14812..14880,14908..14967)) FT /colour=0 FT /note="2 probable transmembrane helices predicted for FT BPSS0015 by TMHMM2.0 at aa 2-21 and 31-53" FT CDS complement(15050..16222) FT /note="Similar to Ralstonia solanacearum putative FT transmembrane protein rsp1060 or rs02397 SWALL:Q8XR08 FT (EMBL:AL646082) (377 aa) fasta scores: E(): 2.7e-87, FT 62.29% id in 366 aa, and to Rhizobium loti hypothetical FT protein mlr2398 SWALL:Q98IH7 (EMBL:AP002999) (390 aa) FT fasta scores: E(): 3.1e-65, 49.2% id in 378 aa" FT /locus_tag="BPSS0016" FT /class="7.0.0" FT /colour=13 FT /product="putative phospholipase" FT misc_feature complement(15515..16159) FT /note="Pfam match to entry PF01734 Patatin, Patatin-like FT phospholipase , score 86.3, E-value 4.2e-23" FT /colour=9 FT CDS complement(16285..17070) FT /note="Similar to Rhizobium meliloti FT D-beta-hydroxybutyrate dehydrogenase BdhA or rb1136 or FT smb21010 SWALL:BDHA_RHIME (SWALL:O86034) (258 aa) fasta FT scores: E(): 2.1e-28, 40.84% id in 262 aa, and to FT Ralstonia solanacearum probable dehydrogenase/reductase FT oxidoreductase protein rsp1059 or rs02396 SWALL:Q8XR09 FT (EMBL:AL646082) (261 aa) fasta scores: E(): 7.1e-76, FT 83.14% id in 261 aa. Note: Also similar to BPSS0354 (268 FT aa) fasta scores: E(): 1.6e-83, 99.615% identity in 260 aa FT overlap" FT /locus_tag="BPSS0017" FT /class="3.4.3" FT /colour=6 FT /product="putative D-beta-hydroxybutyrate dehydrogenase" FT misc_feature complement(16297..17058) FT /note="Pfam match to entry PF00106 adh_short, short chain FT dehydrogenase , score 237.9, E-value 9.2e-69" FT /colour=9 FT misc_feature complement(16558..16644) FT /colour=8 FT /note="PS00061 Short-chain dehydrogenases/reductases FT family signature." FT CDS complement(17117..17857) FT /note="Similar to Clostridium acetobutylicum acetoacetate FT decarboxylase Adc or cap0165 SWALL:ADC_CLOAB FT (SWALL:P23670) (244 aa) fasta scores: E(): 9.2e-53, 56.78% FT id in 236 aa, and to Ralstonia solanacearum probable FT acetoacetate decarboxylase rsp1058 or rs02395 SWALL:Q8XR10 FT (EMBL:AL646082) (247 aa) fasta scores: E(): 1.9e-79, FT 79.35% id in 247 aa" FT /product="acetoacetate decarboxylase" FT /EC_number="4.1.1.4" FT /gene="adc" FT /locus_tag="BPSS0018" FT /class="3.3.21" FT /colour=7 FT CDS 18316..18912 FT /note="Similar to Escherichia coli hypothetical protein FT YbjG or b0841 SWALL:YBJG_ECOLI (SWALL:P75806) (198 aa) FT fasta scores: E(): 2.2e-18, 35.71% id in 196 aa, and to FT Ralstonia solanacearum putative transport transmembrane FT protein rsc3142 or rs00461 SWALL:Q8XUP4 (EMBL:AL646073) FT (199 aa) fasta scores: E(): 2.3e-20, 38.29% id in 188 aa" FT /locus_tag="BPSS0019" FT /class="1.5.5" FT /colour=3 FT /product="putative transport-related membrane protein" FT misc_feature order(18331..18399,18409..18462,18481..18549,18607..18666,18685..18738,18751..18819) FT /colour=0 FT /note="6 probable transmembrane helices predicted for FT BPSS0019 by TMHMM2.0 at aa 19-41, 45-62, 69-91, 111-130, FT 137-154 and 159-181" FT misc_feature 18403..18834 FT /note="Pfam match to entry PF01569 PAP2, PAP2 superfamily FT , score 93.1, E-value 3.6e-25" FT /colour=9 FT CDS complement(18935..19228) FT /locus_tag="BPSS0020" FT /class="4.1.1" FT /colour=3 FT /note="No significant database matches" FT /product="putative membrane protein" FT misc_feature complement(19061..19129) FT /colour=0 FT /note="1 probable transmembrane helix predicted for FT BPSS0020 by TMHMM2.0 at aa 34-56" FT CDS complement(19937..20764) FT /note="Similar to Stigmatella aurantiaca iron utilization FT protein MxcB SWALL:Q9F641 (EMBL:AF299336) (270 aa) fasta FT scores: E(): 1.4e-50, 50.18% id in 271 aa, and to Vibrio FT cholerae vibriobactin utilization protein ViuB or vc2210 FT SWALL:VIUB_VIBCH (SWALL:Q56646) (271 aa) fasta scores: FT E(): 5.4e-20, 33.85% id in 257 aa" FT /locus_tag="BPSS0021" FT /class="1.6.3" FT /colour=0 FT /product="putative iron transport/utilisation related FT protein" FT CDS complement(20804..21508) FT /note="Similar to Ralstonia solanacearum hypothetical FT protein rsp0258 or rs03708 SWALL:Q8XT57 (EMBL:AL646077) FT (218 aa) fasta scores: E(): 1.8e-24, 46.39% id in 222 aa" FT /locus_tag="BPSS0022" FT /class="6.5.0" FT /colour=9 FT /product="PadR-like family regulatory protein" FT misc_feature complement(21047..21277) FT /note="Pfam match to entry PF03551 PadR, Transcriptional FT regulator PadR-like family , score 89.5, E-value 4.3e-24" FT /colour=9 FT CDS 21911..23317 FT /note="Similar to Polyangium cellulosum FT cytochrome-P450-monooxygenase SpiL SWALL:CAD43453 FT (EMBL:AJ505006) (456 aa) fasta scores: E(): 1.1e-16, 25.6% FT id in 457 aa, and to Mycobacterium tuberculosis putative FT cytochrome P450 137 Cyp137 or rv3685c or mt3787 or FT mtv025.033C SWALL:C137_MYCTU (SWALL:O69653) (476 aa) fasta FT scores: E(): 1.8e-16, 25.27% id in 451 aa" FT /locus_tag="BPSS0023" FT /class="7.0.0" FT /colour=13 FT /product="putative cytochrome monooxygenase related FT protein" FT misc_feature 22019..23224 FT /note="Pfam match to entry PF00067 p450, Cytochrome P450 , FT score 36.8, E-value 8.6e-11" FT /colour=9 FT misc_feature 23057..23086 FT /colour=8 FT /note="PS00086 Cytochrome P450 cysteine heme-iron ligand FT signature." FT CDS 23467..23667 FT /locus_tag="BPSS0024" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS 23841..24692 FT /note="Weakly similar to Pseudomonas aeruginosa FT hypothetical protein pa3283 SWALL:Q9HYW0 (EMBL:AE004750) FT (284 aa) fasta scores: E(): 4.9e-12, 33.33% id in 258 aa, FT and to Rhizobium meliloti hypothetical protein rb0508 or FT smb20529 SWALL:Q92W37 (EMBL:AL603643) (309 aa) fasta FT scores: E(): 5.6e-08, 24.68% id in 239 aa" FT /locus_tag="BPSS0025" FT /class="0.0.0" FT /colour=8 FT /product="hypothetical protein" FT CDS 24689..25522 FT /locus_tag="BPSS0026" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS 25519..27462 FT /note="N-terminus is similar to the N-terminal region of FT Pyrococcus horikoshii hypothetical methyltransferase FT ph0819 SWALL:Y819_PYRHO (SWALL:O58549) (459 aa) fasta FT scores: E(): 3.2e-28, 30.07% id in 399 aa, and to the full FT length Methanopyrus kandleri predicted Fe-S oxidoreductase FT mk0992 SWALL:Q8TWP0 (EMBL:AE010388) (483 aa) fasta scores: FT E(): 2.5e-25, 26.53% id in 505 aa" FT /locus_tag="BPSS0027" FT /class="0.0.0" FT /colour=8 FT /product="hypothetical protein" FT CDS 27476..28465 FT /note="Low similarity to Streptomyces lincolnensis LmbW FT protein SWALL:Q54376 (EMBL:X79146) (318 aa) fasta scores: FT E(): 7.2e-08, 25.91% id in 328 aa" FT /locus_tag="BPSS0028" FT /class="0.0.0" FT /colour=8 FT /product="hypothetical protein" FT CDS complement(28637..29257) FT /note="Similar to Brucella melitensis transporter, LysE FT family bmei1274 SWALL:Q8YG87 (EMBL:AE009566) (204 aa) FT fasta scores: E(): 1.5e-30, 49.74% id in 197 aa, and to FT Ralstonia solanacearum probable transmembrane protein FT rsc0385 or rs03353 SWALL:Q8Y2F1 (EMBL:AL646059) (212 aa) FT fasta scores: E(): 7.8e-28, 47.71% id in 197 aa" FT /locus_tag="BPSS0029" FT /class="4.1.1" FT /colour=3 FT /product="putative transport-related membrane protein" FT misc_feature complement(order(28643..28711,28730..28798,28826..28894,28991..29059,29072..29140,29177..29245)) FT /colour=0 FT /note="6 probable transmembrane helices predicted for FT BPSS0029 by TMHMM2.0 at aa 5-27, 40-62, 67-89, 122-144, FT 154-176 and 183-205" FT misc_feature complement(28718..29059) FT /note="Pfam match to entry PF01810 LysE, LysE type FT translocator , score 84.9, E-value 1.1e-22" FT /colour=9 FT CDS 29365..30258 FT /note="Similar to Escherichia coli, Escherichia coli O6, FT and Escherichia coli O157:H7 chromosome initiation FT inhibitor IciA or b2916 or c3497 or z4253 or ecs3786 FT SWALL:ICIA_ECOLI (SWALL:P24194) (297 aa) fasta scores: FT E(): 3.5e-27, 37.59% id in 274 aa, and to Agrobacterium FT tumefaciens transcriptional regulator, LysR family atu0928 FT or agr_c_1691 SWALL:Q8UGV7 (EMBL:AE009057) (319 aa) fasta FT scores: E(): 9.2e-54, 49.48% id in 293 aa" FT /locus_tag="BPSS0030" FT /class="1.2.1" FT /colour=2 FT /product="putative chromosome initiation inhibitor" FT misc_feature 29374..29550 FT /note="Pfam match to entry PF00126 HTH_1, Bacterial FT regulatory helix-turn-helix protein, lysR family , score FT 66.2, E-value 4.5e-17" FT /colour=9 FT misc_feature 29413..29478 FT /note="Predicted helix-turn-helix motif with score FT 2067.000, SD 6.23 at aa 17-38, sequence FT GSFERAAKALNVSPSAVSQRVK" FT /colour=2 FT misc_feature 29416..29508 FT /colour=8 FT /note="PS00044 Bacterial regulatory proteins, lysR family FT signature." FT misc_feature 29506..29541 FT /colour=8 FT /note="PS00070 Aldehyde dehydrogenases cysteine active FT site." FT misc_feature 29620..30243 FT /note="Pfam match to entry PF03466 LysR_substrate, LysR FT substrate binding domain , score 53.1, E-value 4e-13" FT /colour=9 FT CDS complement(30314..31069) FT /note="Similar to Neisseria meningitidis putative FT anaerobic transcriptional regulatory protein nma2107 or FT nmb0380 SWALL:Q9JQQ8 (EMBL:AL162758) (244 aa) fasta FT scores: E(): 3.8e-40, 45.1% id in 235 aa, and to FT Escherichia coli, Escherichia coli O6, and Escherichia FT coli O157:H7 fumarate and nitrate reduction regulatory FT protein Fnr or NirR or b1334 or c1807 or z2433 or ecs1915 FT SWALL:FNR_ECOLI (SWALL:P03019) (250 aa) fasta scores: E(): FT 1.9e-35, 42.47% id in 226 aa" FT /locus_tag="BPSS0031" FT /class="1.6.1" FT /colour=0 FT /product="putative anaerobic growth regulatory protein" FT misc_feature complement(30371..30466) FT /note="Pfam match to entry PF00325 crp, Bacterial FT regulatory proteins, crp family , score 56.8, E-value FT 3e-14" FT /colour=9 FT misc_feature complement(30389..30460) FT /colour=8 FT /note="PS00042 Bacterial regulatory proteins, crp family FT signature." FT misc_feature complement(30395..30460) FT /note="Predicted helix-turn-helix motif with score FT 1625.000, SD 4.72 at aa 204-225, sequence FT MTREDIGSYLGMTLETVSRTLS" FT /colour=2 FT misc_feature complement(30629..30907) FT /note="Pfam match to entry PF00027 cNMP_binding, Cyclic FT nucleotide-binding domain , score 72.4, E-value 6.2e-19" FT /colour=9 FT CDS complement(31219..31686) FT /note="Similar to Ralstonia solanacearum hypothetical FT protein rsc0179 or rs00610 SWALL:Q8Y302 (EMBL:AL646057) FT (151 aa) fasta scores: E(): 6.2e-16, 40.69% id in 145 aa, FT and to Methanosarcina acetivorans universal stress protein FT ma3284 SWALL:Q8TKW0 (EMBL:AE011032) (152 aa) fasta scores: FT E(): 7.3e-11, 37.16% id in 148 aa" FT /locus_tag="BPSS0032" FT /class="7.0.0" FT /colour=13 FT /product="universal stress-related protein" FT misc_feature complement(31252..31686) FT /note="Pfam match to entry PF00582 Usp, Universal stress FT protein family , score 78.3, E-value 1.1e-20" FT /colour=9 FT CDS 32074..32340 FT /locus_tag="BPSS0033" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS 33115..34695 FT /note="Similar to Xanthomonas campestris ketoglutarate FT semialdehyde dehydrogenase xcc3244 SWALL:AAM42514 FT (EMBL:AE012441) (526 aa) fasta scores: E(): 4e-114, 62.14% FT id in 523 aa, and to Vibrio harveyi fatty aldehyde FT dehydrogenase AldH SWALL:DHAF_VIBHA (SWALL:Q56694) (510 FT aa) fasta scores: E(): 6.1e-82, 48.58% id in 494 aa. Note: FT Also similar to BPSS0329 (531 aa) fasta scores: E(): FT 7.2e-91, 60.803% identity in 523 aa overlap" FT /locus_tag="BPSS0034" FT /class="3.4.5" FT /colour=6 FT /product="putative fatty aldehyde dehydrogenase" FT misc_feature 33181..34605 FT /note="Pfam match to entry PF00171 aldedh, Aldehyde FT dehydrogenase family , score -92.4, E-value 1.1e-11" FT /colour=9 FT CDS 34692..35642 FT /note="Similar to Zymomonas mobilis gluconolactonase FT precursor Gnl SWALL:GNL_ZYMMO (SWALL:Q01578) (320 aa) FT fasta scores: E(): 1.4e-14, 33.45% id in 278 aa, and to FT Ralstonia solanacearum putative gluconolactonase precursor FT rsp0824 or rs05371 SWALL:Q8XRK7 (EMBL:AL646081) (353 aa) FT fasta scores: E(): 2.8e-69, 59.2% id in 326 aa" FT /locus_tag="BPSS0035" FT /class="3.3.21" FT /colour=7 FT /product="putative gluconolactonase" FT misc_feature 34791..35639 FT /note="Pfam match to entry PF03758 SMP-30, Senescence FT marker protein-30 (SMP-30) , score -6.2, E-value 2.2e-11" FT /colour=9 FT CDS complement(36388..36804) FT /locus_tag="BPSS0036" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS 37059..37307 FT /locus_tag="BPSS0037" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS 37431..38354 FT /note="Similar to the plasmid borne Synechococcus sp. FT serine acetyltransferase, plasmid SrpH SWALL:SRPH_SYNP7 FT (SWALL:Q59967) (319 aa) fasta scores: E(): 1.3e-62, 59.19% FT id in 299 aa, and to Pseudomonas putida serine FT O-acetyltransferase, putative pp0228 SWALL:AAN65860 FT (EMBL:AE016774) (174 aa) fasta scores: E(): 9.3e-46, FT 74.26% id in 171 aa" FT /locus_tag="BPSS0038" FT /class="3.1.6" FT /colour=7 FT /product="putative serine acetyltransferase" FT misc_feature 37998..38024 FT /note="Pfam match to entry PF00132 hexapep, Bacterial FT transferase hexapeptide (four repeats) , score 2.1, FT E-value 9.2" FT /colour=9 FT misc_feature 38049..38102 FT /note="Pfam match to entry PF00132 hexapep, Bacterial FT transferase hexapeptide (four repeats) , score 14.0, FT E-value 0.24" FT /colour=9 FT misc_feature 38172..38225 FT /note="Pfam match to entry PF00132 hexapep, Bacterial FT transferase hexapeptide (four repeats) , score 9.0, FT E-value 3.4" FT /colour=9 FT misc_feature 38226..38279 FT /note="Pfam match to entry PF00132 hexapep, Bacterial FT transferase hexapeptide (four repeats) , score 10.2, FT E-value 2.4" FT /colour=9 FT CDS complement(38606..39409) FT /note="Similar to Synechocystis sp. FT 3-oxoacyl-[acyl-carrier protein] reductase 1 slr0886 FT SWALL:FAG1_SYNY3 (SWALL:P73574) (247 aa) fasta scores: FT E(): 2.5e-17, 37.55% id in 245 aa, and to Ralstonia FT solanacearum putative oxidoreductase protein rsc0156 or FT rs01026 SWALL:Q8Y325 (EMBL:AL646057) (267 aa) fasta FT scores: E(): 5.9e-28, 41.66% id in 264 aa" FT /locus_tag="BPSS0039" FT /class="7.0.0" FT /colour=13 FT /product="putative dehydrogenase" FT misc_feature complement(38669..39385) FT /note="Pfam match to entry PF00106 adh_short, short chain FT dehydrogenase , score 77.6, E-value 1.7e-20" FT /colour=9 FT CDS complement(39410..39964) FT /note="Similar to Bacillus subtilis GTP cyclohydrolase I FT FolE or MtrA SWALL:GCH1_BACSU (SWALL:P19465) (190 aa) FT fasta scores: E(): 1.6e-29, 47.64% id in 170 aa, and to FT Xanthomonas campestris GTP cyclohydrolase I xcc4166 FT SWALL:GCH1_XANCP (SWALL:Q8P3B0) (200 aa) fasta scores: FT E(): 5.6e-45, 65.69% id in 172 aa. Note: This CDS has a FT possible alternative start codon 156 residues upstream" FT /product="GTP cyclohydrolase I" FT /EC_number="3.5.4.16" FT /gene="folE" FT /gene="mtrA" FT /locus_tag="BPSS0040" FT /class="3.2.5" FT /colour=7 FT misc_feature complement(39461..39808) FT /note="Pfam match to entry PF01227 GTP_cyclohydroI, GTP FT cyclohydrolase I , score 166.5, E-value 2.9e-47" FT /colour=9 FT misc_feature complement(39758..39808) FT /colour=8 FT /note="PS00859 GTP cyclohydrolase I signature 1." FT CDS complement(40276..41202) FT /note="Similar to the plasmid borne Pseudomonas putida FT transcriptional activator protein NahR SWALL:NAHR_PSEPU FT (SWALL:P10183) (300 aa) fasta scores: E(): 4.8e-43, 42.28% FT id in 298 aa, and to Rhizobium tropici nodulation protein FT D1 NodD1 SWALL:NOD1_RHITR (SWALL:Q02876) (308 aa) fasta FT scores: E(): 1.3e-26, 35.01% id in 297 aa" FT /locus_tag="BPSS0041" FT /class="6.3.6" FT /colour=9 FT /product="LysR-family transcriptional regulator" FT misc_feature complement(40303..40932) FT /note="Pfam match to entry PF03466 LysR_substrate, LysR FT substrate binding domain , score 86.4, E-value 3.9e-23" FT /colour=9 FT misc_feature complement(41005..41184) FT /note="Pfam match to entry PF00126 HTH_1, Bacterial FT regulatory helix-turn-helix protein, lysR family , score FT 75.1, E-value 9.5e-20" FT /colour=9 FT misc_feature complement(41080..41145) FT /note="Predicted helix-turn-helix motif with score FT 1352.000, SD 3.79 at aa 20-41, sequence FT RNVSRAGELLGVSQPRVSAALG" FT /colour=2 FT CDS 41316..42539 FT /note="Similar to Pseudomonas aeruginosa p-hydroxybenzoate FT hydroxylase PobA or pa0247 SWALL:PHHY_PSEAE (SWALL:P20586) FT (394 aa) fasta scores: E(): 1.7e-84, 55.21% id in 393 aa, FT and to Ralstonia solanacearum probable 4-hydroxybenzoate FT 3-monooxygenase oxidoreductase protein rsc2242 or rs01317 FT SWALL:Q8XX74 (EMBL:AL646069) (410 aa) fasta scores: E(): FT 2e-111, 69% id in 400 aa" FT /product="p-hydroxybenzoate hydroxylase" FT /EC_number="1.14.13.2" FT /gene="pobA" FT /locus_tag="BPSS0042" FT /class="3.4.3" FT /colour=6 FT misc_feature 41328..41732 FT /note="Pfam match to entry PF01494 FAD_binding_3, FAD FT binding domain , score 117.0, E-value 2.3e-32" FT /colour=9 FT misc_feature 41769..42350 FT /note="Pfam match to entry PF01360 Monooxygenase, FT Monooxygenase , score 158.2, E-value 9e-45" FT /colour=9 FT CDS 42747..43460 FT /note="Similar to Pseudomonas putida 3-oxoadipate FT CoA-transferase subunit A PcaI SWALL:PCAI_PSEPU FT (SWALL:Q01103) (231 aa) fasta scores: E(): 3.5e-63, 75.33% FT id in 223 aa, and to Ralstonia solanacearum probable FT 3-oxoadipate coa-transferase subunit A protein rsc2254 or FT rs01305 SWALL:Q8XX62 (EMBL:AL646069) (229 aa) fasta FT scores: E(): 2.6e-67, 80.34% id in 229 aa" FT /product="3-oxoadipate CoA-transferase subunit A" FT /EC_number="2.8.3.6" FT /gene="pcaI" FT /locus_tag="BPSS0043" FT /class="3.4.3" FT /colour=6 FT misc_feature 42759..43415 FT /note="Pfam match to entry PF01144 CoA_trans, Coenzyme A FT transferase , score 366.6, E-value 1.7e-107" FT /colour=9 FT misc_feature 42798..42845 FT /colour=8 FT /note="PS01273 CoA transferases signature 1." FT CDS 43479..44135 FT /note="Similar to Pseudomonas putida 3-oxoadipate FT CoA-transferase subunit B PcaJ SWALL:PCAJ_PSEPU FT (SWALL:Q01104) (212 aa) fasta scores: E(): 9.6e-62, 76.55% FT id in 209 aa, and to Ralstonia solanacearum probable FT 3-oxoadipate coa-transferase subunit B protein rsc2253 or FT rs01306 SWALL:Q8XX63 (EMBL:AL646069) (220 aa) fasta FT scores: E(): 2.7e-62, 77.98% id in 209 aa" FT /product="3-oxoadipate CoA-transferase subunit B" FT /EC_number="2.8.3.6" FT /gene="pcaJ" FT /locus_tag="BPSS0044" FT /class="3.4.3" FT /colour=6 FT misc_feature 43491..44093 FT /note="Pfam match to entry PF01144 CoA_trans, Coenzyme A FT transferase , score 222.5, E-value 4e-64" FT /colour=9 FT misc_feature 43611..43637 FT /colour=8 FT /note="PS01274 CoA transferases signature 2." FT CDS 44232..45629 FT /note="Similar to Bradyrhizobium japonicum FT 3-carboxy-cis,cis-muconate cycloisomerase PcaB FT SWALL:PCAB_BRAJA (SWALL:O31385) (451 aa) fasta scores: FT E(): 4.4e-79, 55.95% id in 420 aa, and to Pseudomonas FT putida 3-carboxy-cis,cis-muconate cycloisomerase PcaB FT SWALL:PCAB_PSEPU (SWALL:P32427) (407 aa) fasta scores: FT E(): 2.5e-63, 53.82% id in 366 aa. Note: This CDS is FT longer in its N-terminal region than most of its database FT matches" FT /product="3-carboxy-cis,cis-muconate cycloisomerase" FT /EC_number="5.5.1.2" FT /gene="pcaB" FT /locus_tag="BPSS0045" FT /class="3.4.3" FT /colour=6 FT misc_feature 44301..45524 FT /note="Pfam match to entry PF00206 lyase_1, Lyase , score FT 182.0, E-value 6.1e-52" FT /colour=9 FT misc_feature 45102..45131 FT /colour=8 FT /note="PS00163 Fumarate lyases signature." FT CDS 45642..46427 FT /note="Similar to Alcaligenes eutrophus 3-oxoadipate FT enol-lactone hydrolase CatD1 SWALL:Q9EV40 (EMBL:AF042281) FT (260 aa) fasta scores: E(): 3.8e-44, 47.69% id in 260 aa, FT and to Ralstonia solanacearum probable b-ketoadipate FT enol-lactone hydrolase transmembrane protein rsc2250 or FT rs01309 SWALL:Q8XX66 (EMBL:AL646069) (270 aa) fasta FT scores: E(): 5.3e-44, 45% id in 260 aa" FT /locus_tag="BPSS0046" FT /class="3.4.3" FT /colour=6 FT /product="putative lactone hydrolase" FT misc_feature 45789..46418 FT /note="Pfam match to entry PF00561 abhydrolase, alpha/beta FT hydrolase fold , score 104.6, E-value 1.3e-28" FT /colour=9 FT CDS 46443..46829 FT /note="Similar to Acinetobacter calcoaceticus FT 4-carboxymuconolactone decarboxylase PcaC SWALL:DC4C_ACICA FT (SWALL:P20370) (134 aa) fasta scores: E(): 8.8e-29, 57.02% FT id in 121 aa, and to Ralstonia solanacearum putative FT 4-carboxymuconolactone decarboxylase protein rsc2249 or FT rs01310 SWALL:Q8XX67 (EMBL:AL646069) (131 aa) fasta FT scores: E(): 9e-38, 76.98% id in 126 aa" FT /product="4-carboxymuconolactone decarboxylase" FT /EC_number="4.1.1.44" FT /gene="pcaC" FT /locus_tag="BPSS0047" FT /class="3.4.3" FT /colour=6 FT misc_feature 46509..46799 FT /note="Pfam match to entry PF02627 CMD, FT Carboxymuconolactone decarboxylase , score 130.4, E-value FT 2.2e-36" FT /colour=9 FT CDS 47008..48363 FT /note="Similar to Pseudomonas putida 4-hydroxybenzoate FT transporter PcaK SWALL:PCAK_PSEPU (SWALL:Q51955) (448 aa) FT fasta scores: E(): 1.3e-87, 52.08% id in 432 aa, and to FT Acinetobacter calcoaceticus 4-hydroxybenzoate transporter FT PcaK SWALL:PCAK_ACICA (SWALL:Q43975) (457 aa) fasta FT scores: E(): 8.2e-79, 49.32% id in 442 aa" FT /product="4-hydroxybenzoate transporter" FT /gene="pcaK" FT /locus_tag="BPSS0048" FT /class="1.5.5" FT /colour=3 FT misc_feature order(47080..47148,47191..47259,47278..47346,47356..47424,47458..47526,47536..47604,47794..47862,47890..47958,47977..48045,48055..48123,48160..48228,48238..48306) FT /colour=0 FT /note="12 probable transmembrane helices predicted for FT BPSS0048 by TMHMM2.0 at aa 25-47, 62-84, 91-113, 117-139, FT 151-173, 177-199, 263-285, 295-317, 324-346, 350-372, FT 385-407 and 411-433" FT misc_feature 47080..48333 FT /note="Pfam match to entry PF00083 sugar_tr, Sugar (and FT other) transporter , score 51.8, E-value 1e-12" FT /colour=9 FT misc_feature 47245..47295 FT /colour=8 FT /note="PS00216 Sugar transport proteins signature 1." FT misc_feature 47371..47448 FT /colour=8 FT /note="PS00217 Sugar transport proteins signature 2." FT CDS complement(48431..48679) FT /locus_tag="BPSS0049" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS complement(48780..49397) FT /note="Similar to Pseudomonas aeruginosa hypothetical FT protein pa2306 SWALL:Q9I1G9 (EMBL:AE004657) (205 aa) fasta FT scores: E(): 1.3e-40, 53.26% id in 199 aa, and to FT Rhizobium meliloti hypothetical transmembrane protein FT r02108 or smc01425 SWALL:Q92NS0 (EMBL:AL591789) (197 aa) FT fasta scores: E(): 5.7e-38, 52.76% id in 199 aa" FT /locus_tag="BPSS0050" FT /class="4.1.1" FT /colour=3 FT /product="putative membrane protein" FT misc_feature complement(order(48801..48860,48897..48965,49119..49187,49206..49274,49332..49391)) FT /colour=0 FT /note="5 probable transmembrane helices predicted for FT BPSS0050 by TMHMM2.0 at aa 59-78, 98-120, 127-149, 201-223 FT and 236-255" FT CDS complement(49592..50848) FT /note="Similar to Rhizobium meliloti putative transport FT transmembrane protein r00752 or smc00807 SWALL:Q92RU2 FT (EMBL:AL591784) (400 aa) fasta scores: E(): 5.7e-69, FT 56.18% id in 388 aa, and to Thermoplasma acidophilum sugar FT transporter related protein ta1377 SWALL:Q9HIG2 FT (EMBL:AL445067) (381 aa) fasta scores: E(): 3.9e-20, FT 29.24% id in 383 aa. Note: This CDS is longer in its FT N-terminal region than most of its database matches" FT /locus_tag="BPSS0051" FT /class="1.5.5" FT /colour=3 FT /product="putative membrane protein" FT misc_feature complement(order(49676..49744,49862..49930,49991..50050,50078..50146,50225..50284,50312..50380,50492..50560,50603..50671,50684..50752)) FT /colour=0 FT /note="9 probable transmembrane helices predicted for FT BPSS0051 by TMHMM2.0 at aa 33-55, 60-82, 97-119, 157-179, FT 189-208, 235-257, 267-286, 307-329 and 369-391" FT CDS complement(50835..51263) FT /note="Similar to the Ralstonia solanacearum hypothetical FT protein rsp0556 or rs03923 SWALL:Q8XSC2 (EMBL:AL646079) FT (182 aa) fasta scores: E(): 2.2e-39, 72.66% id in 139 aa, FT and to the C-terminal region of Bradyrhizobium japonicum FT superoxide dismutase SodM-like protein SWALL:Q9RH60 FT (EMBL:AF065159) (276 aa) fasta scores: E(): 3.9e-31, 54.9% FT id in 153 aa. CDS is truncated at the C-terminus in FT comparison to both proteins" FT /locus_tag="BPSS0052" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS complement(51665..52855) FT /note="Highly similar to the plasmid borne Alcaligenes FT eutrophus chromate transport protein ChrA SWALL:CHRA_ALCEU FT (SWALL:P17551) (401 aa) fasta scores: E(): 5.6e-109, FT 75.19% id in 387 aa, and to Ralstonia solanacearum FT probable chromate transport transmembrane protein rsp0555 FT or rs03924 SWALL:Q8XSC3 (EMBL:AL646079) (401 aa) fasta FT scores: E(): 4.1e-110, 74.74% id in 396 aa" FT /product="chromate resistance transport protein" FT /gene="chrA" FT /locus_tag="BPSS0053" FT /class="1.4.2" FT /colour=0 FT misc_feature complement(51671..52198) FT /note="Pfam match to entry PF02417 Chromate_transp, FT Chromate transporter , score 55.6, E-value 7e-14" FT /colour=9 FT misc_feature complement(order(51671..51724,51812..51865,51908..51976,51989..52057,52115..52183,52217..52285,52313..52408,52445..52513,52526..52594,52613..52681,52739..52798)) FT /colour=0 FT /note="11 probable transmembrane helices predicted for FT BPSS0053 by TMHMM2.0 at aa 20-39, 59-81, 88-110, 115-137, FT 150-181, 191-213, 225-247, 267-289, 294-316, 331-348 and FT 378-395" FT misc_feature complement(52292..52822) FT /note="Pfam match to entry PF02417 Chromate_transp, FT Chromate transporter , score 271.3, E-value 8.2e-79" FT /colour=9 FT CDS complement(52852..53847) FT /note="Similar to Alcaligenes eutrophus protein ChrB FT SWALL:CHRB_ALCEU (SWALL:P17552) (324 aa) fasta scores: FT E(): 1.2e-64, 54.66% id in 311 aa, and to Ralstonia FT solanacearum probable chromate resistance signal peptide FT protein rsp0554 or rs03925 SWALL:Q8XSC4 (EMBL:AL646079) FT (323 aa) fasta scores: E(): 9.1e-67, 56.01% id in 316 aa" FT /product="chromate resistance exported protein" FT /gene="chrB" FT /locus_tag="BPSS0054" FT /class="1.4.2" FT /colour=0 FT misc_feature complement(53776..53847) FT /note="Signal peptide predicted for BPSS0054 by SignalP FT 2.0 HMM (Signal peptide probability 0.935) with cleavage FT site probability 0.761 between residues 24 and 25" FT /colour=3 FT CDS 54765..55313 FT /note="Similar to Rhizobium loti hypothetical protein FT mll8139 SWALL:Q983W7 (EMBL:AP003013) (174 aa) fasta FT scores: E(): 1.9e-19, 46.28% id in 175 aa, and to FT Pseudomonas aeruginosa hypothetical protein pa2134 FT SWALL:Q9I1Y1 (EMBL:AE004641) (190 aa) fasta scores: E(): FT 8.6e-09, 34.52% id in 168 aa" FT /locus_tag="BPSS0055" FT /class="4.1.0" FT /colour=3 FT /product="putative exported protein" FT misc_feature 54765..54830 FT /note="Signal peptide predicted for BPSS0055 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.999 between residues 22 and 23" FT /colour=3 FT CDS 55366..55668 FT /note="Similar to Rhizobium loti hypothetical protein FT mlr4661 SWALL:Q98DK6 (EMBL:AP003004) (100 aa) fasta FT scores: E(): 5.8e-07, 37.89% id in 95 aa, and to FT Methanosarcina mazei copper-binding protein mm2343 FT SWALL:AAM32039 (EMBL:AE013477) (103 aa) fasta scores: E(): FT 7e-07, 35.41% id in 96 aa" FT /locus_tag="BPSS0056" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT misc_feature 55396..55428 FT /colour=8 FT /note="PS00626 Regulator of chromosome condensation (RCC1) FT signature 2." FT CDS 55704..56372 FT /note="Similar to Escherichia coli, Escherichia coli O6, FT and Escherichia coli O157:H7 RNA polymerase sigma-E factor FT RpoE or SigE or b2573 or c3097 or z3855 or ecs3439 FT SWALL:RPOE_ECOLI (SWALL:P34086) (191 aa) fasta scores: FT E(): 1.5e-14, 33.14% id in 178 aa and to Rhizobium FT meliloti putative RNA polymerase sigma factor protein Rpo FT or rb1504 or smb20592 SWALL:Q92TK7 (EMBL:AL603647) (227 FT aa) fasta scores: E(): 9e-31, 42.72% id in 220 aa" FT /locus_tag="BPSS0057" FT /class="6.2.1" FT /colour=9 FT /product="putative RNA polymerase sigma factor" FT misc_feature 56175..56240 FT /note="Predicted helix-turn-helix motif with score FT 1151.000, SD 3.11 at aa 171-192, sequence FT LSVEETAQCLGIPEATVRSRHF" FT /colour=2 FT CDS 56852..62767 FT /note="N-terminal region similar to Micrococcus luteus FT excinuclease ABC subunit A uvrA SWALL:UVRA_MICLU FT (SWALL:P13567) (992 aa) fasta scores: E(): 2.4e-33, 41.63% FT id in 1052 aa, and C-terminal region similar to FT Mycobacterium tuberculosis excinuclease ABC subunit A FT rv1638 or mt1675 or mtcy06h11.02 SWALL:UVRA_MYCTU FT (SWALL:P94972) (972 aa) fasta scores: E(): 2.8e-31, 41.73% FT id in 1016 aa. Note: This CDS seems to have duplicated FT itself forming a whole CDS which N-terminal region is FT highly similar to its C-terminal region" FT /product="putative excinuclease ABC subunit A" FT /gene="uvrA" FT /locus_tag="BPSS0058" FT /class="2.2.3" FT /colour=2 FT misc_feature 56930..58624 FT /note="Pfam match to entry PF00005 ABC_tran, ABC FT transporter , score 36.2, E-value 6.4e-09" FT /colour=9 FT misc_feature 56951..56974 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT misc_feature 58838..59710 FT /note="Pfam match to entry PF00005 ABC_tran, ABC FT transporter , score 62.7, E-value 5.2e-16" FT /colour=9 FT misc_feature 58859..58882 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT misc_feature 59438..59482 FT /colour=8 FT /note="PS00211 ABC transporters family signature." FT misc_feature 59987..61405 FT /note="Pfam match to entry PF00005 ABC_tran, ABC FT transporter , score 29.7, E-value 2e-08" FT /colour=9 FT misc_feature 60008..60031 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT misc_feature 61175..61219 FT /colour=8 FT /note="PS00211 ABC transporters family signature." FT misc_feature 61640..62602 FT /note="Pfam match to entry PF00005 ABC_tran, ABC FT transporter , score 63.5, E-value 2.9e-16" FT /colour=9 FT misc_feature 61661..61684 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT misc_feature 62147..62164 FT /colour=8 FT /note="PS00190 Cytochrome c family heme-binding site FT signature." FT misc_feature 62348..62392 FT /colour=8 FT /note="PS00211 ABC transporters family signature." FT CDS complement(63800..64060) FT /note="Similar to Enterobacter aerogenes KluA SWALL:Q93KC6 FT (EMBL:U67194) (89 aa) fasta scores: E(): 6.5e-12, 53.84% FT id in 78 aa, and to Pseudomonas sp. hypothetical 10.2 kDa FT protein orf2 SWALL:Q937D1 (EMBL:U66917) (93 aa) fasta FT scores: E(): 6.7e-12, 53.84% id in 78 aa, and to Rhizobium FT meliloti hypothetical protein rb0121 or smb20121 FT SWALL:Q92X41 (EMBL:AL603642) (91 aa) fasta scores: E(): FT 6.5e-10, 43.67% id in 87 aa" FT /locus_tag="BPSS0059" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS 64719..64991 FT /locus_tag="BPSS0060" FT /class="0.0.0" FT /colour=8 FT /product="hypothetical protein" FT /note="No significant database matches" FT CDS complement(65274..65573) FT /note="Similar to Salmonella typhimurium, and Salmonella FT typhi DNA-binding protein H-NS Hns SWALL:HNS_SALTY FT (SWALL:P17428) (136 aa) fasta scores: E(): 3, 29.31% id in FT 116 aa, and to Ralstonia solanacearum putative HNS-like FT transcription regulator protein rs00711 SWALL:Q8XSY2 FT (EMBL:AL646078) (96 aa) fasta scores: E(): 1.5e-14, 58.16% FT id in 98 aa" FT /product="putative H-NS-like DNA-binding protein" FT /colour=9 FT /class="6.5.0" FT /locus_tag="BPSS0060B" FT CDS 66124..67476 FT /note="Similar to Escherichia coli alpha-ketoglutarate FT permease KgtP or WitA or b2587 SWALL:KGTP_ECOLI FT (SWALL:P17448) (432 aa) fasta scores: E(): 4.5e-84, 51.63% FT id in 428 aa, and to Ralstonia solanacearum putative FT alpha-ketoglutarate permease transmembrane protein rsp0007 FT or rs01979 SWALL:Q8XTU7 (EMBL:AL646076) (447 aa) fasta FT scores: E(): 5.9e-131, 77.87% id in 443 aa. CDS is FT extended at the N-terminus in comparison to orthologues" FT /product="alpha-ketoglutarate permease" FT /gene="kgtP" FT /gene="witA" FT /locus_tag="BPSS0061" FT /class="1.5.5" FT /colour=3 FT misc_feature 66226..67470 FT /note="Pfam match to entry PF00083 sugar_tr, Sugar (and FT other) transporter , score 215.4, E-value 5.6e-62" FT /colour=9 FT misc_feature order(66274..66327,66355..66423,66442..66501,66514..66582,66643..66711,66748..66816,66901..66969,67012..67080,67099..67167,67180..67248,67285..67353,67381..67440) FT /colour=0 FT /note="12 probable transmembrane helices predicted for FT BPSS0061 by TMHMM2.0 at aa 66-83, 93-115, 122-141, FT 146-168, 189-211, 224-246, 275-297, 312-334, 341-363, FT 368-390, 403-425 and 435-454" FT misc_feature 66409..66459 FT /colour=8 FT /note="PS00216 Sugar transport proteins signature 1." FT misc_feature 66559..66636 FT /colour=8 FT /note="PS00217 Sugar transport proteins signature 2." FT misc_feature 67066..67119 FT /colour=8 FT /note="PS00216 Sugar transport proteins signature 1." FT CDS 67529..69460 FT /note="Similar to Ralstonia solanacearum probable FT C4-dicarboxylate transport sensor kinase transcription FT regulator protein dctb1 or rsp0008 or rs01980 SWALL:Q8XTU6 FT (EMBL:AL646076) (634 aa) fasta scores: E(): 4.7e-73, FT 54.57% id in 634 aa, and to Rhizobium leguminosarum FT C4-dicarboxylate transport sensor protein DctB FT SWALL:DCTB_RHILE (SWALL:P10047) (622 aa) fasta scores: FT E(): 2.3e-24, 31.02% id in 635 aa" FT /locus_tag="BPSS0062" FT /class="6.1.1" FT /colour=9 FT /product="putative C4-dicarboxylate transport sensor FT kinase" FT misc_feature order(67562..67630,68474..68542) FT /colour=0 FT /note="2 probable transmembrane helices predicted for FT BPSS0062 by TMHMM2.0 at aa 12-34 and 316-338" FT misc_feature 68747..68953 FT /note="Pfam match to entry PF00512 HisKA, His Kinase A FT (phosphoacceptor) domain , score 33.1, E-value 4.2e-07" FT /colour=9 FT misc_feature 69077..69424 FT /note="Pfam match to entry PF02518 HATPase_c, Histidine FT kinase-, DNA gyrase B-, and HSP90-like ATPase , score FT 121.1, E-value 1.4e-33" FT /colour=9 FT CDS 69444..70790 FT /note="Similar to Rhizobium meliloti C4-dicarboxylate FT transport transcriptional regulatory protein DctD or FT rb1525 or smb20613 SWALL:DCTD_RHIME (SWALL:P13632) (460 FT aa) fasta scores: E(): 7.2e-75, 51.82% id in 438 aa, and FT to Escherichia coli, and Escherichia coli O157:H7 nitrogen FT regulation protein Nr GlnG or NtrC or GlnT or b3868 or FT z5404 or ecs4790 SWALL:NTRC_ECOLI (SWALL:P06713) (469 aa) FT fasta scores: E(): 9.6e-53, 41.1% id in 472 aa" FT /product="C4-dicarboxylate transport transcriptional FT response regulator" FT /gene="dctD" FT /locus_tag="BPSS0063" FT /class="6.1.2" FT /colour=9 FT misc_feature 69474..69839 FT /note="Pfam match to entry PF00072 response_reg, Response FT regulator receiver domain , score 122.4, E-value 5.4e-34" FT /colour=9 FT misc_feature 69705..69734 FT /colour=8 FT /note="PS00758 ArgE / dapE / ACY1 / CPG2 / yscS family FT signature 1." FT misc_feature 69891..70553 FT /note="Pfam match to entry PF00158 Sigma54_activat, FT Sigma-54 interaction domain , score 413.7, E-value FT 1.1e-121" FT /colour=9 FT misc_feature 69963..70004 FT /colour=8 FT /note="PS00675 Sigma-54 interaction domain ATP-binding FT region A signature." FT misc_feature 70146..70193 FT /colour=8 FT /note="PS00676 Sigma-54 interaction domain ATP-binding FT region B signature." FT misc_feature 70527..70556 FT /colour=8 FT /note="PS00688 Sigma-54 interaction domain C-terminal part FT signature." FT misc_feature 70635..70757 FT /note="Pfam match to entry PF02954 HTH_8, Bacterial FT regulatory protein, Fis family , score 48.8, E-value FT 7.6e-12" FT /colour=9 FT misc_feature 70686..70751 FT /note="Predicted helix-turn-helix motif with score FT 1000.000, SD 2.59 at aa 415-436, sequence FT GQVAKAAELLGLPRKTLYDKIT" FT /colour=2 FT CDS complement(72252..72812) FT /locus_tag="BPSS0064" FT /class="4.1.1" FT /colour=3 FT /note="No significant database matches. Possible FT alternative translational start sites" FT /product="putative membrane protein" FT misc_feature complement(order(72504..72572,72582..72650)) FT /colour=0 FT /note="2 probable transmembrane helices predicted for FT BPSS0064 by TMHMM2.0 at aa 83-105 and 109-131" FT CDS 73093..75045 FT /note="Weak similarity to the C-terminal region of FT Anabaena sp. hypothetical protein all2038 SWALL:Q8YVE0 FT (EMBL:AP003588) (743 aa) fasta scores: E(): 3.5e-14, FT 30.93% id in 682 aa" FT /locus_tag="BPSS0065" FT /class="4.1.0" FT /colour=3 FT /product="putative exported protein" FT misc_feature 73093..73185 FT /note="Signal peptide predicted for BPSS0065 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.834 between residues 31 and 32" FT /colour=3 FT misc_feature 73324..73347 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT CDS 75296..75802 FT /note="Similar to the C-terminal region of Pseudomonas FT aeruginosa ornithine utilization regulator OruR or pa0831 FT SWALL:ORUR_PSEAE (SWALL:P72171) (339 aa) fasta scores: FT E(): 2.1e-10, 35.13% id in 148 aa, and to Mycobacterium FT tuberculosis hypothetical transcriptional regulator rv1395 FT or mt1440 or mtcy21b4.12 SWALL:YD95_MYCTU (SWALL:P71663) FT (344 aa) fasta scores: E(): 4.4e-10, 36.55% id in 145 aa. FT Possible gene remnant" FT /locus_tag="BPSS0066" FT /class="6.3.2" FT /colour=9 FT /product="AraC family regulatory protein" FT misc_feature 75509..75643 FT /note="Pfam match to entry PF00165 HTH_AraC, Bacterial FT regulatory helix-turn-helix proteins, araC family , score FT 4.5, E-value 0.87" FT /colour=9 FT misc_feature 75545..75610 FT /note="Predicted helix-turn-helix motif with score FT 1342.000, SD 3.76 at aa 100-121, sequence FT PSLARLASKLFLSERTLKRRLQ" FT /colour=2 FT misc_feature 75662..75793 FT /note="Pfam match to entry PF00165 HTH_AraC, Bacterial FT regulatory helix-turn-helix proteins, araC family , score FT 34.7, E-value 1.4e-07" FT /colour=9 FT CDS 76174..78369 FT /note="Similar to Pseudomonas aeruginosa non-hemolytic FT phospholipase C precursor PlcN or pa3319 SWALL:PHLN_PSEAE FT (SWALL:P15713) (692 aa) fasta scores: E(): 6e-54, 53.29% FT id in 728 aa, and to Burkholderia pseudomallei FT non-hemolytic phospholipase C precursor PlcN FT SWALL:PHLN_BURPS (SWALL:Q9RGS8) (700 aa) fasta scores: FT E(): 4e-39, 45.43% id in 744 aa" FT /locus_tag="BPSS0067" FT /class="5.1.5" FT /colour=0 FT /product="putative phospholipase C precursor" FT misc_feature 76174..76272 FT /note="Signal peptide predicted for BPSS0067 by SignalP FT 2.0 HMM (Signal peptide probability 0.992) with cleavage FT site probability 0.782 between residues 33 and 34" FT /colour=3 FT CDS 78867..79601 FT /note="No significant database matches" FT /locus_tag="BPSS0068" FT /class="0.0.0" FT /colour=8 FT /product="hypothetical protein" FT CDS complement(join(79598..79903,81358..81459,81461..81880,81884..81967)) FT /note="Pseudogene. Similar to Bacteriophage phiE125 TnpB FT SWALL:Q8W6R2 (EMBL:AF447491) (284 aa) fasta scores: E(): FT 4.2e-95, 85.21% id in 284 aa, and to Xanthomonas FT axonopodis transposase xac2432 SWALL:Q8PJU8 FT (EMBL:AE011880) (301 aa) fasta scores: E(): 4.2e-77, FT 68.12% id in 298 aa. CDS contains nonsense and frameshift FT mutations is distrupted by the integration of an IS FT element" FT /product="transposase (pseudogene)" FT /locus_tag="BPSS0069" FT /class="5.1.4" FT /colour=11 FT /pseudo FT misc_feature complement(79649..79897) FT /note="Pfam match to entry PF00665 rve, Integrase core FT domain , score 36.6, E-value 1.5e-10" FT /colour=9 FT CDS 80077..81324 FT /note="Similar to Escherichia coli transposase InsI for FT insertion sequence element IB30B/C/D (InsI1 or b0256) and FT (InsI2 or b1404) and (InsI3 or b4284) SWALL:INSI_ECOLI FT (SWALL:P37246) (383 aa) fasta scores: E(): 8.3e-21, 39.17% FT id in 388 aa, and to Alcaligenes eutrophus transposase for FT insertion sequence element IS1086 SWALL:TRA8_ALCEU FT (SWALL:P37248) (339 aa) fasta scores: E(): 3.8e-19, 42.2% FT id in 372 aa" FT /locus_tag="BPSS0070" FT /class="5.1.4" FT /colour=12 FT /product="putative transposase" FT misc_feature 80077..80142 FT /note="Predicted helix-turn-helix motif with score FT 1216.000, SD 3.33 at aa 1-22, sequence FT METEAAALACNVSQPLGPRWLR" FT /colour=2 FT misc_feature 80077..80586 FT /note="Predicted helix-turn-helix motif with score FT 1119.000, SD 3.00 at aa 1-170, sequence FT METEAAALACNVSQPLGPRWLREAGGVAPIDLAPHSGRYLPFSEREEIALLWAQDCS FT VREISRRLQRSPSTISRELRRNAATRGGTLVYRATVAQWKAEGAAERPNASKLAEND FT QLRTYVQDRLAGTVTDYRGEPIPGPNVPWKGRRQGRHADRRWATCWSPEQISRRIQ" FT /colour=2 FT misc_feature 80142..80242 FT /note="Predicted helix-turn-helix motif with score FT 1216.000, SD 3.33 at aa 56-22, sequence FT REAGGVAPIDLAPHSGRYLPFSEREEIALLWAQDC" FT /colour=2 FT misc_feature 80242..80307 FT /note="Predicted helix-turn-helix motif with score FT 1216.000, SD 3.33 at aa 56-77, sequence FT CSVREISRRLQRSPSTISRELR" FT /colour=2 FT misc_feature 80521..80586 FT /note="Predicted helix-turn-helix motif with score FT 1119.000, SD 3.00 at aa 149-170, sequence FT GRHADRRWATCWSPEQISRRIQ" FT /colour=2 FT misc_feature 80797..81303 FT /note="Pfam match to entry PF00665 rve, Integrase core FT domain , score 72.5, E-value 5.7e-19" FT /colour=9 FT misc_feature 81142..81192 FT /colour=8 FT /note="PS01043 Transposases, IS30 family, signature." FT misc_feature complement(81455..81592) FT /note="Pfam match to entry PF00665 rve, Integrase core FT domain , score 18.5, E-value 2.5e-05" FT /colour=9 FT CDS complement(join(81964..82059,82059..82289)) FT /note="Pseudogene. Similar to Burkholderia cepacia FT insertion element IS401 hypothetical 12.4 kDa protein FT SWALL:YISX_BURCE (SWALL:Q51647) (107 aa) fasta scores: FT E(): 2.6e-25, 72.22% id in 108 aa, and to Bacteriophage FT phiE125 TnpA SWALL:Q8W6R1 (EMBL:AF447491) (92 aa) fasta FT scores: E(): 8.6e-25, 84.78% id in 92 aa. CDS contains FT frameshift mutation after codon 77" FT /product="IS element hypothetical protein (pseudogene)" FT /locus_tag="BPSS0072" FT /class="5.1.4" FT /colour=11 FT /pseudo FT CDS 82774..82938 FT /note="Partial CDS. Similar to the C-terminal region of FT Ralstonia solanacearum hypothetical protein rsc3358 or FT rs02633 SWALL:Q8XU36 (EMBL:AL646074) (179 aa) fasta FT scores: E(): 0.00013, 46.51% id in 43 aa, and of FT Neurospora crassa histone H3 methyltransferase Dim-5 FT SWALL:Q8X225 (EMBL:AF419248) (318 aa) fasta scores: E(): FT 0.49, 37.5% id in 48 aa" FT /product="conserved hypothetical protein (fragment)" FT /locus_tag="BPSS0072A" FT /colour=11 FT /class="0.0.2" FT /pseudo FT CDS complement(82938..83957) FT /note="Similar to Pseudomonas aeruginosa ornithine FT utilization regulator OruR or pa0831 SWALL:ORUR_PSEAE FT (SWALL:P72171) (339 aa) fasta scores: E(): 4.4e-20, 27.92% FT id in 333 aa and to Pseudomonas aeruginosa probable FT transcriptional regulator pa2704 SWALL:Q9I0D8 FT (EMBL:AE004698) (339 aa) fasta scores: E(): 3.1e-28, FT 32.39% id in 321 aa" FT /locus_tag="BPSS0073" FT /class="6.5.0" FT /colour=9 FT /product="putative regulatory protein" FT CDS 84049..84411 FT /locus_tag="BPSS0074" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS 84913..85833 FT /note="Similar to Escherichia coli spermidine/putrescine FT transport system permease protein PotB or b1125 FT SWALL:POTB_ECOLI (SWALL:P23860) (275 aa) fasta scores: FT E(): 7.8e-29, 34.69% id in 245 aa, and to Pseudomonas FT aeruginosa probable permease of ABC transporter pa0325 FT SWALL:Q9I6G6 (EMBL:AE004470) (309 aa) fasta scores: E(): FT 3.4e-49, 49.08% id in 273 aa" FT /locus_tag="BPSS0075" FT /class="4.1.1" FT /colour=3 FT /product="putative ABC transport system, membrane protein" FT misc_feature order(84973..85041,85174..85242,85267..85335,85420..85488,85549..85617,85720..85788) FT /colour=0 FT /note="6 probable transmembrane helices predicted for FT BPSS0075 by TMHMM2.0 at aa 21-43, 88-110, 119-141, FT 170-192, 213-235 and 270-292" FT misc_feature 85483..85701 FT /note="Pfam match to entry PF00528 BPD_transp, FT Binding-protein-dependent transport systems inner membrane FT component , score 40.4, E-value 2.7e-09" FT /colour=9 FT misc_feature 85486..85572 FT /colour=8 FT /note="PS00402 Binding-protein-dependent transport systems FT inner membrane comp. sign." FT CDS 85817..86671 FT /note="Similar to Escherichia coli, Escherichia coli O6, FT and Escherichia coli O157:H7 spermidine/putrescine FT transport system permease protein PotC or b1124 or c1399 FT or z1763 or ecs1500 SWALL:POTC_ECOLI (SWALL:P23859) (264 FT aa) fasta scores: E(): 8.6e-29, 33.84% id in 260 aa, and FT to Pseudomonas aeruginosa probable permease of ABC FT transporter pa0324 SWALL:Q9I6G7 (EMBL:AE004470) (262 aa) FT fasta scores: E(): 2.9e-42, 47.52% id in 263 aa" FT /locus_tag="BPSS0076" FT /class="4.1.1" FT /colour=3 FT /product="putative ABC transport system, membrane protein" FT misc_feature order(85850..85918,86024..86092,86129..86197,86213..86281,86438..86497,86525..86593) FT /colour=0 FT /note="6 probable transmembrane helices predicted for FT BPSS0076 by TMHMM2.0 at aa 12-34, 70-92, 105-127, 133-155, FT 208-227 and 237-259" FT misc_feature 86285..86506 FT /note="Pfam match to entry PF00528 BPD_transp, FT Binding-protein-dependent transport systems inner membrane FT component , score 53.3, E-value 3.6e-13" FT /colour=9 FT CDS 86668..87699 FT /note="Similar to Escherichia coli FT spermidine/putrescine-binding periplasmic protein FT precursor PotD or b1123 SWALL:POTD_ECOLI (SWALL:P23861) FT (348 aa) fasta scores: E(): 2.3e-25, 26.23% id in 343 aa, FT and to Pseudomonas aeruginosa probable binding protein FT component of ABC transporter pa0323 SWALL:Q9I6G8 FT (EMBL:AE004470) (347 aa) fasta scores: E(): 9.7e-69, FT 48.19% id in 332 aa" FT /locus_tag="BPSS0077" FT /class="4.1.0" FT /colour=3 FT /product="putative ABC transport system, exported FT substrate-binding protein" FT misc_feature 86668..86721 FT /note="Signal peptide predicted for BPSS0077 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.996 between residues 18 and 19" FT /colour=3 FT misc_feature 86731..87624 FT /note="Pfam match to entry PF01547 SBP_bac_1, Bacterial FT extracellular solute-binding protein , score 36.7, E-value FT 3.6e-08" FT /colour=9 FT CDS 88287..88592 FT /note="Similar to Ralstonia solanacearum putative HNS-like FT transcription regulator protein rsp0335 or rs00711 FT SWALL:Q8XSY2 (EMBL:AL646078) (96 aa) fasta scores: E(): FT 1.5e-10, 43.29% id in 97 aa, and to Bordetella pertussis FT Bph3 SWALL:O07507 (EMBL:U82566) (123 aa) fasta scores: FT E(): 0.00073, 32.72% id in 110 aa" FT /class="6.5.0" FT /colour=9 FT /locus_tag="BPSS0077A" FT /product="putative HNS-like regulatory protein" FT CDS 88921..91692 FT /note="Similar to Ralstonia solanacearum putative FT VGR-related protein rsp0518 or rs06151 SWALL:Q8XSF8 FT (EMBL:AL646079) (908 aa) fasta scores: E(): 1.1e-90, FT 41.55% id in 900 aa, and to Escherichia coli VgrE protein FT SWALL:O52660 (EMBL:AF044499) (702 aa) fasta scores: E(): FT 0.00017, 25% id in 532 aa" FT /locus_tag="BPSS0078" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT misc_feature 91588..91611 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT CDS 91706..93946 FT /note="Similar to Pseudomonas aeruginosa hypothetical FT protein pa0260 SWALL:Q9I6M9 (EMBL:AE004464) (716 aa) fasta FT scores: E(): 1.5e-24, 31.81% id in 770 aa" FT /locus_tag="BPSS0079" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT misc_feature 92477..92506 FT /colour=8 FT /note="PS00120 Lipases, serine active site." FT misc_feature 92933..92956 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT CDS 94259..95614 FT /note="Similar to parts of Pseudomonas aeruginosa FT hypothetical protein pa0259 SWALL:Q9I6N0 (EMBL:AE004464) FT (480 aa) fasta scores: E(): 2.3e-15, 27.19% id in 478 aa" FT /locus_tag="BPSS0080" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS 95624..95887 FT /note="Similar to Ralstonia solanacearum hypothetical FT protein RSC3217 or RS02434 SWALL:Q8XUH1 (EMBL:AL646074) FT (90 aa) fasta scores: E(): 3e-20, 62.79% id in 86 aa, and FT to the N-terminal region of Burkholderia thailandensis FT bacteriophage protein GP29 SWALL:Q8VP97 (EMBL:AY063741) FT (186 aa) fasta scores: E(): 5e-07, 42.35% id in 85 aa" FT /product="conserved hypothetical protein" FT /locus_tag="BPSS0080a" FT /colour=10 FT /class="0.0.2" FT CDS complement(96302..96721) FT /note="Similar to Escherichia coli, and Escherichia coli FT O157:H7 hypothetical protein YjbQ or b4056 or z5655 or FT ecs5038 SWALL:YJBQ_ECOLI (SWALL:P32698) (138 aa) fasta FT scores: E(): 1.2e-18, 42.85% id in 133 aa, and to FT Rhizobium meliloti hypothetical protein r02310 or smc01559 FT SWALL:Q92NA3 (EMBL:AL591790) (140 aa) fasta scores: E(): FT 6.2e-28, 56.42% id in 140 aa" FT /locus_tag="BPSS0081" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT misc_feature complement(96311..96673) FT /note="Pfam match to entry PF01894 UPF0047, FT Uncharacterised protein family UPF0047 , score 198.4, FT E-value 7.2e-57" FT /colour=9 FT CDS complement(96741..97067) FT /note="Similar to Xanthomonas axonopodis thioredoxin TrxA FT or xac0109 SWALL:AAM35001 (EMBL:AE011634) (109 aa) fasta FT scores: E(): 2.1e-17, 50% id in 96 aa, and to Pseudomonas FT aeruginosa probable thioredoxin pa2694 SWALL:Q9I0E8 FT (EMBL:AE004697) (108 aa) fasta scores: E(): 1.1e-22, FT 60.78% id in 102 aa" FT /locus_tag="BPSS0082" FT /class="3.2.15" FT /colour=7 FT /product="putative thioredoxin" FT CDS 97539..98231 FT /locus_tag="BPSS0083" FT /class="4.1.0" FT /colour=3 FT /note="No significant database matches" FT /product="putative exported protein" FT misc_feature 97539..97718 FT /note="Signal peptide predicted for BPSS0083 by SignalP FT 2.0 HMM (Signal peptide probability 0.684) with cleavage FT site probability 0.590 between residues 49 and 50" FT /colour=3 FT CDS complement(98726..98863) FT /note="Gene remnant. Similar to internal region of FT Burkholderia cepacia OpcP1 SWALL:Q45106 (EMBL:D63823) (361 FT aa) fasta scores: E(): 1.9e-05, 58.06% id in 31 aa, and FT Ralstonia solanacearum probable porin signal peptide FT protein rsc2108 or rs01496 SWALL:Q8XXK5 (EMBL:AL646068) FT (381 aa) fasta scores: E(): 0.00028, 61.29% id in 31 aa. FT Feature lacks translational stop and start codons" FT /locus_tag="BPSS0084" FT /class="4.1.1" FT /colour=11 FT /product="putative porin-related protein (fragment)" FT /pseudo FT CDS complement(98817..99440) FT /note="Similar to Ralstonia solanacearum probable FT transmembrane protein rsc0361 or rs03329 SWALL:Q8Y2H5 FT (EMBL:AL646058) (171 aa) fasta scores: E(): 2e-11, 33.96% FT id in 159 aa. Weakly similar to Bordetella parapertussis FT putative membrane protein bpp4203 SWALL:Q7W345 FT (EMBL:BX640436) (181 aa) fasta scores: E(): 0.00057, FT 27.16% id in 162 aa. CDS is extended at the C- and FT N-termini in comparison to the R. solanacearum protein. FT The presence of a gene remnant overlapping the C-terminus FT of the CDS (BPSS0084) suggest that this may be a partial FT gene" FT /locus_tag="BPSS0085" FT /class="4.1.1" FT /colour=3 FT /product="putative membrane protein" FT misc_feature complement(order(99147..99215,99225..99284)) FT /colour=0 FT /note="2 probable transmembrane helices predicted for FT BPSS0085 by TMHMM2.0 at aa 85-104 and 108-130" FT CDS complement(99533..101128) FT /note="Similar to Bradyrhizobium japonicum cytochrome C FT oxidase polypeptide I CtaD or CoxA SWALL:COX1_BRAJA FT (SWALL:P31833) (541 aa) fasta scores: E(): 3.4e-116, FT 54.49% id in 534 aa, and to Rhizobium leguminosarum FT cytochrome C oxidase polypeptide I CtaD or CoxA FT SWALL:COX1_RHILE (SWALL:Q08855) (538 aa) fasta scores: FT E(): 5.8e-116, 56.18% id in 534 aa" FT /locus_tag="BPSS0086" FT /class="3.5.1" FT /colour=1 FT /product="putative cytochrome C oxidase-related protein" FT misc_feature complement(order(99662..99730,99788..99856,99893..99961,100004..100072,100109..100177,100220..100288,100307..100375,100448..100516,100574..100642,100700..100768,100826..100885,100961..101029)) FT /colour=0 FT /note="12 probable transmembrane helices predicted for FT BPSS0086 by TMHMM2.0 at aa 54-76, 102-121, 141-163, FT 183-205, 225-247, 272-294, 301-323, 338-360, 373-395, FT 410-432, 445-467 and 487-509" FT misc_feature complement(99701..101059) FT /note="Pfam match to entry PF00115 COX1, Cytochrome C and FT Quinol oxidase polypeptide I , score 830.6, E-value FT 3.5e-247" FT /colour=9 FT misc_feature complement(100211..100375) FT /colour=8 FT /note="PS00077 Heme-copper oxidase catalytic subunit, FT copper B binding region signature." FT CDS complement(102280..103737) FT /locus_tag="BPSS0087" FT /class="4.1.1" FT /colour=3 FT /note="No significant database matches" FT /product="putative membrane protein" FT misc_feature complement(103651..103719) FT /colour=0 FT /note="1 probable transmembrane helix predicted for FT BPSS0087 by TMHMM2.0 at aa 48-70" FT CDS 105290..107227 FT /note="No significant database matches to the full length FT CDS. Similar to parts of Xanthomonas axonopodis outer FT membrane protein XadA or xac3546 SWALL:AAM38389 FT (EMBL:AE012003) (2190 aa) fasta scores: E(): 1.5e-48, FT 41.17% id in 629 aa" FT /locus_tag="BPSS0088" FT /class="4.1.0" FT /colour=3 FT /product="putative exported protein" FT misc_feature 105290..105352 FT /note="Signal peptide predicted for BPSS0088 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.962 between residues 21 and 22" FT /colour=3 FT misc_feature 105539..105568 FT /note="Pfam match to entry PF02339 SGXXSG, Aggrecan core FT protein repeat , score 0.1, E-value 1.7e+02" FT /colour=9 FT misc_feature 105623..105652 FT /note="Pfam match to entry PF02339 SGXXSG, Aggrecan core FT protein repeat , score 0.1, E-value 1.7e+02" FT /colour=9 FT misc_feature 105707..105736 FT /note="Pfam match to entry PF02339 SGXXSG, Aggrecan core FT protein repeat , score 2.6, E-value 56" FT /colour=9 FT misc_feature 105791..105820 FT /note="Pfam match to entry PF02339 SGXXSG, Aggrecan core FT protein repeat , score 0.1, E-value 1.7e+02" FT /colour=9 FT misc_feature 105875..105904 FT /note="Pfam match to entry PF02339 SGXXSG, Aggrecan core FT protein repeat , score 1.9, E-value 76" FT /colour=9 FT misc_feature 105959..105988 FT /note="Pfam match to entry PF02339 SGXXSG, Aggrecan core FT protein repeat , score 1.9, E-value 76" FT /colour=9 FT misc_feature 106043..106072 FT /note="Pfam match to entry PF02339 SGXXSG, Aggrecan core FT protein repeat , score 1.3, E-value 1e+02" FT /colour=9 FT misc_feature 106127..106156 FT /note="Pfam match to entry PF02339 SGXXSG, Aggrecan core FT protein repeat , score 2.6, E-value 56" FT /colour=9 FT misc_feature 106211..106240 FT /note="Pfam match to entry PF02339 SGXXSG, Aggrecan core FT protein repeat , score 2.6, E-value 56" FT /colour=9 FT misc_feature 106295..106324 FT /note="Pfam match to entry PF02339 SGXXSG, Aggrecan core FT protein repeat , score 0.1, E-value 1.7e+02" FT /colour=9 FT misc_feature 106379..106408 FT /note="Pfam match to entry PF02339 SGXXSG, Aggrecan core FT protein repeat , score 1.9, E-value 76" FT /colour=9 FT misc_feature 106463..106492 FT /note="Pfam match to entry PF02339 SGXXSG, Aggrecan core FT protein repeat , score 2.6, E-value 56" FT /colour=9 FT misc_feature 106547..106576 FT /note="Pfam match to entry PF02339 SGXXSG, Aggrecan core FT protein repeat , score 2.6, E-value 56" FT /colour=9 FT CDS complement(107294..108781) FT /note="Similar to Ralstonia solanacearum putative FT transmembrane protein rsp0161 or rs05517 SWALL:Q8XTF1 FT (EMBL:AL646076) (517 aa) fasta scores: E(): 3.2e-115, FT 57.32% id in 485 aa, and to Xanthomonas axonopodis FT hypothetical protein xac3119 SWALL:AAM37964 FT (EMBL:AE011956) (504 aa) fasta scores: E(): 2.5e-104, FT 53.07% id in 471 aa" FT /locus_tag="BPSS0089" FT /class="4.1.0" FT /colour=3 FT /product="putative exported protein" FT misc_feature complement(108713..108781) FT /note="Signal peptide predicted for BPSS0089 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.917 between residues 23 and 24" FT /colour=3 FT CDS complement(109043..109597) FT /note="Low similarity to Yersinia pestis putative exported FT protein ypo1208 SWALL:Q8ZGS3 (EMBL:AJ414147) (175 aa) FT fasta scores: E(): 3.4e-08, 27.71% id in 166 aa, and to FT Salmonella typhimurium putative inner membrane protein FT YfaZ or stm2294 SWALL:Q8ZNF6 (EMBL:AE008803) (215 aa) FT fasta scores: E(): 8.4e-07, 29.56% id in 159 aa" FT /locus_tag="BPSS0090" FT /class="4.1.0" FT /colour=3 FT /product="putative exported protein" FT misc_feature complement(109301..109363) FT /colour=8 FT /note="PS00107 Protein kinases ATP-binding region FT signature." FT misc_feature complement(109478..109597) FT /note="Signal peptide predicted for BPSS0090 by SignalP FT 2.0 HMM (Signal peptide probability 0.999) with cleavage FT site probability 0.995 between residues 40 and 41" FT /colour=3 FT CDS 110182..110727 FT /note="Similar to Escherichia coli f17 fimbrial protein FT precursor f17a-A SWALL:FMF3_ECOLI (SWALL:P11312) (180 aa) FT fasta scores: E(): 1.1e-12, 35% id in 180 aa, and to FT Yersinia pestis frimbrial protein ypo2945 SWALL:Q8ZCN6 FT (EMBL:AJ414154) (181 aa) fasta scores: E(): 4.5e-15, FT 37.83% id in 185 aa" FT /locus_tag="BPSS0091" FT /class="4.1.5" FT /colour=0 FT /product="putative fimbrial protein" FT misc_feature 110194..110253 FT /colour=0 FT /note="1 probable transmembrane helix predicted for FT BPSS0091 by TMHMM2.0 at aa 5-24" FT misc_feature 110269..110724 FT /note="Pfam match to entry PF00419 Fimbrial, Fimbrial FT protein , score 98.8, E-value 6.7e-27" FT /colour=9 FT misc_feature 110572..110592 FT CDS 110792..111529 FT /note="Similar to Escherichia coli chaperone protein FT precursor EcpD or b0140 SWALL:ECPD_ECOLI (SWALL:P33128) FT (246 aa) fasta scores: E(): 3.4e-36, 45.04% id in 242 aa, FT and to Bordetella pertussis chaperone protein precursor FT FimB or FhaD SWALL:FIMB_BORPE (SWALL:P33409) (244 aa) FT fasta scores: E(): 4.8e-31, 44.08% id in 245 aa" FT /locus_tag="BPSS0092" FT /class="1.3.1" FT /colour=0 FT /product="putative fimbria-related chaperone" FT misc_feature 110807..110860 FT /note="Signal peptide predicted for BPSS0092 by SignalP FT 2.0 HMM (Signal peptide probability 0.999) with cleavage FT site probability 0.975 between residues 18 and 19" FT /colour=3 FT misc_feature 110861..111232 FT /note="Pfam match to entry PF00345 pili_assembly, FT Gram-negative pili assembly chaperone, N-terminal domain , FT score 228.2, E-value 7.9e-66" FT /colour=9 FT misc_feature 111092..111145 FT /colour=8 FT /note="PS00635 Gram-negative pili assembly chaperone FT signature." FT misc_feature 111245..111517 FT /note="Pfam match to entry PF02753 pili_assembly_C, FT Gram-negative pili assembly chaperone, C-terminal domain , FT score 37.7, E-value 1.8e-08" FT /colour=9 FT CDS 111753..114386 FT /note="Similar to Escherichia coli outer membrane usher FT protein precursor AfaC SWALL:AFAC_ECOLI (SWALL:P53517) FT (859 aa) fasta scores: E(): 8.4e-77, 33.4% id in 877 aa" FT /product="outer membrane usher protein" FT /locus_tag="BPSS0093" FT /class="4.1.5" FT /colour=0 FT misc_feature 111846..114263 FT /note="Pfam match to entry PF00577 Usher, Fimbrial Usher FT protein , score 976.4, E-value 4.7e-291" FT /colour=9 FT misc_feature 114153..114215 FT /colour=8 FT /note="PS00107 Protein kinases ATP-binding region FT signature." FT CDS 114379..114951 FT /note="Similar to Xylella fastidiosa fimbrial subunit FT precursor xf0083 SWALL:Q9PH63 (EMBL:AE003862) (184 aa) FT fasta scores: E(): 9.2e-12, 37.5% id in 176 aa, and to FT Escherichia coli F17 fimbrial protein precursor F17a-A FT SWALL:FMF3_ECOLI (SWALL:P11312) (180 aa) fasta scores: FT E(): 4.4e-10, 38.46% id in 169 aa" FT /locus_tag="BPSS0094" FT /class="4.1.5" FT /colour=0 FT /product="putative fimbria subunit protein" FT misc_feature 114379..114477 FT /note="Signal peptide predicted for BPSS0094 by SignalP FT 2.0 HMM (Signal peptide probability 0.998) with cleavage FT site probability 0.724 between residues 33 and 34" FT /colour=3 FT misc_feature 114442..114474 FT /colour=8 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site." FT misc_feature 114496..114948 FT /note="Pfam match to entry PF00419 Fimbrial, Fimbrial FT protein , score 83.4, E-value 3e-22" FT /colour=9 FT CDS 115016..115672 FT /note="Similar to Yersinia pestis putative membrane FT protein ypo1468 or ypo0975 or y2703 or y3366 SWALL:Q8XF18 FT (EMBL:AJ414148) (228 aa) fasta scores: E(): 8.8e-07, FT 27.67% id in 206 aa" FT /locus_tag="BPSS0095" FT /class="4.1.1" FT /colour=3 FT /product="putative membrane protein" FT CDS 115675..117351 FT /note="Similar to Yersinia pestis putative membrane FT protein ypo2953 or y1530 SWALL:Q8ZCM8 (EMBL:AJ414154) (560 FT aa) fasta scores: E(): 8.4e-25, 23.54% id in 565 aa, and FT to Yersinia pestis putative OmpA-family membrane protein FT ypo0974 or y2702 or y3365 SWALL:Q8ZHC6 (EMBL:AJ414145) FT (578 aa) fasta scores: E(): 7.2e-19, 28.17% id in 575 aa" FT /locus_tag="BPSS0096" FT /class="4.1.1" FT /colour=3 FT /product="OmpA family membrane protein" FT misc_feature 115675..115758 FT /note="Signal peptide predicted for BPSS0096 by SignalP FT 2.0 HMM (Signal peptide probability 0.802) with cleavage FT site probability 0.294 between residues 28 and 29" FT /colour=3 FT misc_feature order(115693..115761,115771..115830,116668..116736) FT /colour=0 FT /note="3 probable transmembrane helices predicted for FT BPSS0096 by TMHMM2.0 at aa 7-29, 33-52 and 332-354" FT misc_feature 116995..117285 FT /note="Pfam match to entry PF00691 OmpA, OmpA family , FT score 81.5, E-value 1.1e-21" FT /colour=9 FT CDS 117729..118268 FT /note="Similar to Yersinia pestis hypothetical protein FT ypo2939 SWALL:Q8ZCN9 (EMBL:AJ414154) (174 aa) fasta FT scores: E(): 2.4e-48, 84.75% id in 164 aa, and to FT Salmonella typhi hypothetical protein sty0297 SWALL:Q8Z970 FT (EMBL:AL627266) (180 aa) fasta scores: E(): 6.7e-48, FT 76.66% id in 180 aa. Note: Also similar to BPSS0173 (194 FT aa) fasta scores: E(): 2e-48, 81.818% identity in 165 aa FT overlap" FT /locus_tag="BPSS0097" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS 118302..119801 FT /note="Similar to Yersinia pestis hypothetical protein FT ypo2938 SWALL:Q8ZCP0 (EMBL:AJ414154) (500 aa) fasta FT scores: E(): 1.3e-175, 84.6% id in 500 aa, and to FT Salmonella enterica subsp. enterica serovar Typhimurium FT SciI protein SWALL:Q93IS7 (EMBL:AJ320483) (497 aa) fasta FT scores: E(): 9.3e-171, 83.36% id in 499 aa. Note: Also FT similar to BPSS0172 (500 aa) fasta scores: E(): 1.5e-182, FT 84.168% identity in 499 aa overlap" FT /locus_tag="BPSS0098" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS 120001..120483 FT /note="Similar to Salmonella typhimurium, and Salmonella FT enterica subsp. enterica serovar Typhimurium putative FT cytoplasmic protein stm0279 or SciM SWALL:Q93IS3 FT (EMBL:AE008707) (161 aa) fasta scores: E(): 8e-39, 63.29% FT id in 158 aa, and to Yersinia pestis hypothetical protein FT ypo2937 SWALL:Q8ZCP1 (EMBL:AJ414154) (161 aa) fasta FT scores: E(): 7.9e-38, 55.69% id in 158 aa. Note: Also FT similar to BPSS0171 (162 aa) fasta scores: E(): 1.8e-43, FT 66.456% identity in 158 aa overlap" FT /locus_tag="BPSS0099" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS 120671..121153 FT /note="Similar to Salmonella enterica subsp. enterica FT serovar Typhimurium SciN protein precursor SciN FT SWALL:Q93IS2 (EMBL:AJ320483) (163 aa) fasta scores: E(): FT 5.3e-21, 39.21% id in 153 aa, and to Pseudomonas FT aeruginosa hypothetical protein pa0080 SWALL:Q9I752 FT (EMBL:AE004447) (154 aa) fasta scores: E(): 1.4e-12, FT 35.24% id in 122 aa. Note: Also similar to BPSS0170 (171 FT aa) fasta scores: E(): 5.8e-24, 45.860% identity in 157 aa FT overlap" FT /locus_tag="BPSS0100" FT /class="4.1.0" FT /colour=3 FT /product="putative exported protein" FT misc_feature 120671..120727 FT /note="Signal peptide predicted for BPSS0100 by SignalP FT 2.0 HMM (Signal peptide probability 0.913) with cleavage FT site probability 0.767 between residues 19 and 20" FT /colour=3 FT misc_feature 120998..121021 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT CDS 121159..122508 FT /note="Similar to Yersinia pestis hypothetical protein FT ypo2934 or y1549 SWALL:Q8ZCP3 (EMBL:AJ414154) (449 aa) FT fasta scores: E(): 3.1e-111, 62.61% id in 444 aa, and to FT Salmonella typhi hypothetical protein sty0304 SWALL:Q8Z966 FT (EMBL:AL627266) (447 aa) fasta scores: E(): 2.7e-97, 57.9% FT id in 449 aa. Note: Also similar to BPSS0169 (449 aa) FT fasta scores: E(): 1.1e-108, 62.054% identity in 448 aa FT overlap" FT /locus_tag="BPSS0101" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS 122505..123806 FT /note="Similar to Salmonella typhi putative membrane FT protein sty0305 SWALL:Q8Z965 (EMBL:AL627266) (433 aa) FT fasta scores: E(): 1.8e-76, 55.78% id in 380 aa, and to FT Yersinia pestis putative OmpA-family membrane protein FT ypo0514 SWALL:Q8ZII3 (EMBL:AJ414143) (536 aa) fasta FT scores: E(): 3.2e-24, 30.93% id in 375 aa. Note: The FT N-terminal region of this CDS does not present FT similarities to any of the database matches. Also similar FT to BPSS0168 (422 aa) fasta scores: E(): 1.9e-61, 46.283% FT identity in 417 aa overlap" FT /locus_tag="BPSS0102" FT /class="4.1.1" FT /colour=3 FT /product="OmpA family membrane protein" FT misc_feature 123237..123296 FT /colour=0 FT /note="1 probable transmembrane helix predicted for FT BPSS0102 by TMHMM2.0 at aa 245-264" FT misc_feature 123483..123779 FT /note="Pfam match to entry PF00691 OmpA, OmpA family , FT score 96.9, E-value 2.6e-26" FT /colour=9 FT CDS 123821..127729 FT /note="Similar to Salmonella enterica subsp. enterica FT serovar Typhimurium SciS protein precursor SWALL:Q93IR7 FT (EMBL:AJ320483) (1289 aa) fasta scores: E(): 8.3e-165, FT 45.82% id in 1305 aa, and to Yersinia pestis putative FT membrane protein ypo2724 SWALL:Q8ZD68 (EMBL:AJ414153) FT (1275 aa) fasta scores: E(): 2.4e-94, 34.01% id in 1317 FT aa. Note: Also similar to BPSS0167 (1359 aa) fasta scores: FT E(): 3.2e-101, 47.210% identity in 1362 aa overlap" FT /locus_tag="BPSS0103" FT /class="4.1.1" FT /colour=3 FT /product="putative membrane protein" FT misc_feature order(123854..123922,123950..124018,124037..124093,124121..124189,125417..125476) FT /colour=0 FT /note="5 probable transmembrane helices predicted for FT BPSS0103 by TMHMM2.0 at aa 12-34, 44-66, 73-91, 101-123 FT and 533-552" FT misc_feature 124406..124429 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT misc_feature 126887..126910 FT /colour=8 FT /note="PS00501 Signal peptidases I serine active site." FT CDS 127919..128488 FT /locus_tag="BPSS0104" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS 128553..131252 FT /note="Similar in almost its full length to Yersinia FT pestis hypothetical protein ypo2725 SWALL:Q8ZD67 FT (EMBL:AJ414153) (921 aa) fasta scores: E(): 8e-76, 45.87% FT id in 896 aa, C-terminal region to Shigella flexneri FT Rhs-family protein sf0265 SWALL:AAN41925 (EMBL:AE015061) FT (737 aa) fasta scores: E(): 7.7e-48, 41.75% id in 697 aa, FT and C-terminal region where the highly repetitive fragment FT is to Thermoproteus tenax virus 1 viral protein Tpx FT SWALL:VTP3_TTV1V (SWALL:P19275) (474 aa) fasta scores: FT E(): 1.6e-32, 59.53% id in 304 aa. Note: Contains a highly FT repetitive region at the C-terminal domain" FT /locus_tag="BPSS0105" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT misc_feature 130398..130439 FT /colour=8 FT /note="PS00147 Arginase family signature 1." FT CDS join(131327..131593,131597..135061) FT /note="Pseudogene. Similar to Salmonella typhi Rhs-family FT protein sty0321 SWALL:Q8Z953 (EMBL:AL627266) (1354 aa) FT fasta scores: E(): 7e-85, 33.22% id in 1222 aa, and to FT Yersinia pestis Rhs-like protein y0266 SWALL:AAM83860 FT (EMBL:AE013626) (963 aa) fasta scores: E(): 3.5e-63, FT 28.91% id in 875 aa. CDS contains a nonsense mutation FT (ochre) after codon 91" FT /locus_tag="BPSS0106" FT /class="7.0.0" FT /colour=11 FT /product="putative Rhs-like protein (pseudogene)" FT /pseudo FT misc_feature 134030..134053 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT CDS complement(134954..136312) FT /note="Similar to Yersinia pestis hypothetical protein FT ypo2951 or y1532 SWALL:Q8ZCN0 (EMBL:AJ414154) (445 aa) FT fasta scores: E(): 4e-50, 36.11% id in 407 aa" FT /locus_tag="BPSS0108" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS complement(136345..137373) FT /note="Similar to Yersinia pestis putative fimbrial FT protein ypo2950 or y1533 SWALL:Q8ZCN1 (EMBL:AJ414154) (343 FT aa) fasta scores: E(): 0.00019, 23.52% id in 357 aa, and FT C-terminal region to Salmonella typhimurium fimbrial-like FT protein precursor FimF or stm0548 SWALL:FIMF_SALTY FT (SWALL:P37926) (172 aa) fasta scores: E(): 0.41, 27.38% id FT in 168 aa" FT /locus_tag="BPSS0109" FT /class="4.1.0" FT /colour=3 FT /product="putative exported protein" FT misc_feature complement(137305..137373) FT /note="Signal peptide predicted for BPSS0109 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.812 between residues 23 and 24" FT /colour=3 FT CDS complement(137428..138498) FT /note="Similar to Salmonella typhimurium, and Salmonella FT enterica subsp. enterica serovar Typhimurium putative FT cytoplasmic protein stm0266 or SciA SWALL:Q93IT5 FT (EMBL:AE008707) (351 aa) fasta scores: E(): 9.6e-42, FT 43.42% id in 350 aa, and to Yersinia pestis hypothetical FT protein ypo2949 SWALL:Q8ZCN2 (EMBL:AJ414154) (393 aa) FT fasta scores: E(): 1.1e-31, 38.03% id in 376 aa. Note: FT Also similar to BPSS0180 (382 aa) fasta scores: E(): FT 3.7e-28, 44.101% identity in 356 aa overlap" FT /locus_tag="BPSS0110" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS complement(138517..139566) FT /note="Similar to Yersinia pestis hypothetical protein FT ypo2948 SWALL:Q8ZCN3 (EMBL:AJ414154) (341 aa) fasta FT scores: E(): 5.7e-72, 52.1% id in 332 aa, and to FT Salmonella enterica subsp. enterica serovar Typhimurium FT SciB protein SWALL:Q93IT4 (EMBL:AJ320483) (291 aa) fasta FT scores: E(): 9.5e-68, 57.54% id in 285 aa. Note: Also FT similar to BPSS0179 (363 aa) fasta scores: E(): 2.8e-68, FT 55.224% identity in 335 aa overlap" FT /locus_tag="BPSS0111" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS complement(139563..141443) FT /note="Similar to Yersinia pestis hypothetical protein FT ypo2947 or y1537 SWALL:Q8ZCN4 (EMBL:AJ414154) (626 aa) FT fasta scores: E(): 3.3e-177, 64.05% id in 626 aa, and to FT Salmonella enterica subsp. enterica serovar Typhimurium FT SciC protein SWALL:Q93IT3 (EMBL:AJ320483) (627 aa) fasta FT scores: E(): 8.1e-163, 60.92% id in 627 aa. Note: Also FT similar to BPSS0178 (630 aa) fasta scores: E(): 1.5e-156, FT 63.796% identity in 627 aa overlap" FT /locus_tag="BPSS0112" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS complement(141445..141963) FT /note="Similar to Salmonella typhimurium, and Salmonella FT enterica subsp. enterica serovar Typhimurium putative FT cytoplasmic protein stm0269 or SciD SWALL:Q93IT2 FT (EMBL:AE008707) (164 aa) fasta scores: E(): 1.2e-21, FT 43.79% id in 153 aa, and to Yersinia pestis hypothetical FT protein ypo2728 or y1561 SWALL:Q8ZD64 (EMBL:AJ414153) (159 FT aa) fasta scores: E(): 3.1e-20, 40.12% id in 157 aa. Note: FT Also similar to BPSS0177 (194 aa) fasta scores: E(): FT 1.6e-24, 45.912% identity in 159 aa overlap" FT /locus_tag="BPSS0113" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS complement(141950..142804) FT /note="Similar to Salmonella enterica subsp. enterica FT serovar Typhimurium SciE protein SWALL:Q93IT1 FT (EMBL:AJ320483) (279 aa) fasta scores: E(): 5.9e-38, FT 39.85% id in 276 aa, and to Yersinia pestis hypothetical FT protein ypo2727 or y1560 SWALL:Q8ZD65 (EMBL:AJ414153) (268 FT aa) fasta scores: E(): 8.6e-36, 39.36% id in 254 aa. Note: FT Also similar to BPSS0176 (322 aa) fasta scores: E(): FT 4.8e-29, 39.590% identity in 293 aa overlap" FT /locus_tag="BPSS0114" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS complement(142788..143843) FT /locus_tag="BPSS0115" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS 144273..146918 FT /note="Similar to Salmonella typhimurium, and Salmonella FT enterica subsp. enterica serovar Typhimurium putative FT ATPase with chaperone activity, homolog of Yersinia ClpB FT stm0272 or SciG SWALL:Q93IS9 (EMBL:AE008707) (879 aa) FT fasta scores: E(): 4.1e-196, 63.58% id in 865 aa, and to FT Yersinia pestis putative Clp ATPase ClpB or ypo0506 or FT y3669 SWALL:Q8ZIJ2 (EMBL:AJ414143) (867 aa) fasta scores: FT E(): 1.9e-121, 44.6% id in 843 aa" FT /locus_tag="BPSS0116" FT /class="1.3.1" FT /colour=13 FT /product="putative chaperone-related protein" FT misc_feature 144585..144626 FT /colour=8 FT /note="PS00213 Lipocalin signature." FT misc_feature 144960..145544 FT /note="Pfam match to entry PF00004 AAA, ATPase family FT associated with various cellular activities (AAA) , score FT 27.8, E-value 5.1e-07" FT /colour=9 FT misc_feature 144975..144998 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT misc_feature 145239..145277 FT /colour=8 FT /note="PS00870 Chaperonins clpA/B signature 1." FT misc_feature 146118..146141 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT CDS complement(147309..150353) FT /note="Similar to Ralstonia solanacearum probable capsular FT synthesis regulatory RcsC or rsp1622 or rs02179 FT SWALL:Q8XPL6 (EMBL:AL646086) (1098 aa) fasta scores: E(): FT 1.2e-48, 27.88% id in 1126 aa, and C-terminal region to FT Escherichia coli sensor protein EvgS precursor or b2370 FT SWALL:EVGS_ECOLI (SWALL:P30855) (1197 aa) fasta scores: FT E(): 2.1e-40, 32.07% id in 555 aa" FT /locus_tag="BPSS0117" FT /class="6.1.3" FT /colour=9 FT /product="putative histidine kinase/response regulator FT fusion protein" FT misc_feature complement(147639..147998) FT /note="Pfam match to entry PF00072 response_reg, Response FT regulator receiver domain , score 110.1, E-value 2.8e-30" FT /colour=9 FT misc_feature complement(148077..148424) FT /note="Pfam match to entry PF02518 HATPase_c, Histidine FT kinase-, DNA gyrase B-, and HSP90-like ATPase , score FT 130.5, E-value 2e-36" FT /colour=9 FT misc_feature complement(148563..148760) FT /note="Pfam match to entry PF00512 HisKA, His Kinase A FT (phosphoacceptor) domain , score 98.4, E-value 9.2e-27" FT /colour=9 FT misc_feature complement(order(149205..149273,150192..150260)) FT /colour=0 FT /note="2 probable transmembrane helices predicted for FT BPSS0117 by TMHMM2.0 at aa 32-54 and 361-383" FT CDS 151025..151285 FT /locus_tag="BPSS0118" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS complement(151956..152618) FT /note="Similar to Escherichia coli, Escherichia coli O6, FT and Escherichia coli O157:H7 capsular synthesis regulator FT component B RcsB or b2217 or c2760 or z3476 or ecs3106 FT SWALL:RCSB_ECOLI (SWALL:P14374) (216 aa) fasta scores: FT E(): 9.3e-24, 41.34% id in 208 aa, and to Pseudomonas FT aeruginosa probable response regulator pa4080 SWALL:Q9HWU8 FT (EMBL:AE004824) (214 aa) fasta scores: E(): 6.8e-35, FT 47.84% id in 209 aa. Note: Also similar to BPSS0124 (243 FT aa) fasta scores: E(): 3.7e-33, 45.283% identity in 212 aa FT overlap" FT /locus_tag="BPSS0119" FT /class="6.1.2" FT /colour=9 FT /product="putative two-component system response FT regulator" FT misc_feature complement(151971..152168) FT /note="Pfam match to entry PF00196 GerE, Bacterial FT regulatory proteins, luxR family , score 77.6, E-value FT 1.7e-20" FT /colour=9 FT misc_feature complement(152034..152117) FT /colour=8 FT /note="PS00622 Bacterial regulatory proteins, luxR family FT signature." FT misc_feature complement(152049..152114) FT /note="Predicted helix-turn-helix motif with score FT 1137.000, SD 3.06 at aa 169-190, sequence FT LSVNEIANRLKRSKQTISSQKA" FT /colour=2 FT misc_feature complement(152229..152603) FT /note="Pfam match to entry PF00072 response_reg, Response FT regulator receiver domain , score 82.7, E-value 4.9e-22" FT /colour=9 FT CDS complement(153167..155551) FT /note="Similar to Yersinia pestis putative outer membrane FT fimbrial usher protein ypo0302 or y0562 SWALL:Q8ZJ27 FT (EMBL:AJ414142) (792 aa) fasta scores: E(): 1.4e-120, FT 42.67% id in 764 aa, and to Escherichia coli outer FT membrane usher protein precursor FanD SWALL:FAND_ECOLI FT (SWALL:P12050) (783 aa) fasta scores: E(): 5.4e-22, 22.91% FT id in 768 aa" FT /locus_tag="BPSS0120" FT /class="4.1.5" FT /colour=0 FT /product="putative fimbrial usher protein" FT misc_feature complement(153221..155449) FT /note="Pfam match to entry PF00577 Usher, Fimbrial Usher FT protein , score 159.6, E-value 3.5e-45" FT /colour=9 FT misc_feature complement(154661..154693) FT /colour=8 FT /note="PS01151 Fimbrial biogenesis outer membrane usher FT protein signature." FT misc_feature complement(155450..155551) FT /note="Signal peptide predicted for BPSS0120 by SignalP FT 2.0 HMM (Signal peptide probability 0.999) with cleavage FT site probability 0.520 between residues 34 and 35" FT /colour=3 FT CDS complement(155912..156622) FT /note="Similar to Yersinia pestis putative fimbrial FT chaperone ypo0303 or y0563 SWALL:Q8ZJ26 (EMBL:AJ414142) FT (247 aa) fasta scores: E(): 3.3e-35, 46.26% id in 201 aa, FT and to Escherichia coli hypothetical fimbrial chaperone FT precursor YhcA or b3215 SWALL:YHCA_ECOLI (SWALL:P28722) FT (224 aa) fasta scores: E(): 5.9e-18, 30.49% id in 223 aa" FT /locus_tag="BPSS0121" FT /class="1.3.1" FT /colour=0 FT /product="putative fimbrial chaperone" FT misc_feature complement(156326..156520) FT /note="Pfam match to entry PF00345 pili_assembly, FT Gram-negative pili assembly chaperone, N-terminal domain , FT score 34.5, E-value 5.6e-10" FT /colour=9 FT misc_feature complement(156524..156622) FT /note="Signal peptide predicted for BPSS0121 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 1.000 between residues 33 and 34" FT /colour=3 FT CDS complement(157098..157745) FT /note="Similar to Yersinia pestis putative exported FT protein ypo0301 or y0561 SWALL:Q8ZJ28 (EMBL:AJ414142) (212 FT aa) fasta scores: E(): 3.1e-26, 41.09% id in 219 aa" FT /locus_tag="BPSS0122" FT /class="4.1.0" FT /colour=3 FT /product="putative exported protein" FT misc_feature complement(157674..157745) FT /note="Signal peptide predicted for BPSS0122 by SignalP FT 2.0 HMM (Signal peptide probability 0.989) with cleavage FT site probability 0.973 between residues 24 and 25" FT /colour=3 FT CDS complement(157968..158624) FT /note="Similar to Yersinia pestis putative exported FT protein ypo0301 or y0561 SWALL:Q8ZJ28 (EMBL:AJ414142) (212 FT aa) fasta scores: E(): 6.2e-34, 48.13% id in 214 aa" FT /locus_tag="BPSS0123" FT /class="4.1.0" FT /colour=3 FT /product="putative exported protein" FT misc_feature complement(158559..158624) FT /note="Signal peptide predicted for BPSS0123 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.999 between residues 36 and 37" FT /colour=3 FT CDS 159632..160324 FT /note="Similar to Escherichia coli, Escherichia coli O6, FT and Escherichia coli O157:H7 capsular synthesis regulator FT component B RcsB or b2217 or c2760 or z3476 or ecs3106 FT SWALL:RCSB_ECOLI (SWALL:P14374) (216 aa) fasta scores: FT E(): 1.5e-21, 35.61% id in 205 aa, and to Pseudomonas FT aeruginosa probable response regulator pa4080 SWALL:Q9HWU8 FT (EMBL:AE004824) (214 aa) fasta scores: E(): 9.9e-31, FT 47.61% id in 210 aa. Note: Also similar to BPSS0119 (221 FT aa) fasta scores: E(): 6.9e-29, 45.283% identity in 212 aa FT overlap" FT /locus_tag="BPSS0124" FT /class="6.1.2" FT /colour=9 FT /product="putative response regulator" FT misc_feature 159638..160012 FT /note="Pfam match to entry PF00072 response_reg, Response FT regulator receiver domain , score 82.4, E-value 6.2e-22" FT /colour=9 FT misc_feature 160082..160279 FT /note="Pfam match to entry PF00196 GerE, Bacterial FT regulatory proteins, luxR family , score 59.4, E-value FT 5.2e-15" FT /colour=9 FT CDS complement(160633..160926) FT /note="Similar to Ralstonia solanacearum putative HNS-like FT transcription regulator protein rsp0029 or rs02004 FT SWALL:Q8XTS5 (EMBL:AL646076) (95 aa) fasta scores: E(): FT 4e-06, 34.4% id in 93 aa, and low similarity to FT Rhodobacter capsulatus trans-acting regulatory protein FT HvrA SWALL:HVRA_RHOCA (SWALL:P42505) (102 aa) fasta FT scores: E(): 0.84, 31.64% id in 79 aa" FT /locus_tag="BPSS0125" FT /class="6.5.0" FT /colour=9 FT /product="putative regulatory protein" FT CDS 161417..162742 FT /note="Similar to Agrobacterium vitis putative tartrate FT transporter TtuB SWALL:TUB3_AGRVI (SWALL:P70786) (449 aa) FT fasta scores: E(): 1.5e-62, 42.23% id in 412 aa, and to FT Xanthomonas campestris MFS transporter xcc4227 FT SWALL:AAM43443 (EMBL:AE012550) (461 aa) fasta scores: E(): FT 1.2e-100, 61.88% id in 446 aa. Note: This CDS is shorter FT in its N-terminal region than most of its database FT matches" FT /locus_tag="BPSS0126" FT /class="1.5.3" FT /colour=3 FT /product="putative transport system, membrane protein" FT misc_feature 161435..162733 FT /note="Pfam match to entry PF00083 sugar_tr, Sugar (and FT other) transporter , score -90.8, E-value 0.00012" FT /colour=9 FT misc_feature order(161483..161536,161603..161671,161690..161749,161765..161833,161870..161938,161975..162043,162197..162265,162293..162352,162386..162439,162452..162520,162533..162601,162659..162712) FT /colour=0 FT /note="12 probable transmembrane helices predicted for FT BPSS0126 by TMHMM2.0 at aa 23-40, 63-85, 92-111, 117-139, FT 152-174, 187-209, 261-283, 293-312, 324-341, 346-368, FT 373-395 and 415-432" FT misc_feature 162272..162358 FT /colour=8 FT /note="PS00107 Protein kinases ATP-binding region FT signature." FT misc_feature 162338..162361 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT CDS 162816..163982 FT /note="Similar to Escherichia coli glycerate kinase 1 GlxK FT or GlxB5 or b0514 SWALL:GRK1_ECOLI (SWALL:P77364) (381 aa) FT fasta scores: E(): 2.6e-63, 55.05% id in 376 aa, and to FT Xanthomonas axonopodis glycerate kinase xac4360 FT SWALL:AAM39190 (EMBL:AE012090) (389 aa) fasta scores: E(): FT 1.6e-77, 64.3% id in 381 aa" FT /product="glycerate kinase 1" FT /EC_number="2.7.1.31" FT /gene="glxK" FT /gene="glxB5" FT /locus_tag="BPSS0127" FT /class="3.3.5" FT /colour=7 FT misc_feature 162816..163946 FT /note="Pfam match to entry PF02595 DUF168, Uncharacterized FT BCR, COG1929 , score 650.6, E-value 5.3e-193" FT /colour=9 FT CDS 164175..165629 FT /note="Similar to Bacillus stearothermophilus pyruvate FT kinase Pyk SWALL:KPYK_BACST (SWALL:Q02499) (587 aa) fasta FT scores: E(): 1.7e-60, 41.27% id in 470 aa, and to FT Pseudomonas aeruginosa pyruvate kinase I PykF or pa1498 FT SWALL:Q9I3L4 (EMBL:AE004578) (477 aa) fasta scores: E(): FT 1.5e-83, 55.57% id in 466 aa" FT /product="pyruvate kinase" FT /EC_number="2.7.1.40" FT /gene="pyk" FT /locus_tag="BPSS0128" FT /class="3.5.5" FT /colour=1 FT misc_feature 164199..165224 FT /note="Pfam match to entry PF00224 PK, Pyruvate kinase, FT barrel domain , score 472.9, E-value 1.6e-139" FT /colour=9 FT misc_feature 164832..164870 FT /colour=8 FT /note="PS00110 Pyruvate kinase active site signature." FT misc_feature 165258..165605 FT /note="Pfam match to entry PF02887 PK_C, Pyruvate kinase, FT alpha/beta domain , score 40.1, E-value 3.4e-09" FT /colour=9 FT CDS 165876..167096 FT /note="Similar to Escherichia coli carbohydrate diacid FT regulator CdaR or SdaR SWALL:CDAR_ECOLI (SWALL:P37047) FT (385 aa) fasta scores: E(): 8.2e-49, 40.63% id in 379 aa, FT and to Xanthomonas campestris sugar diacide regulator FT xcc4225 SWALL:Q8P353 (EMBL:AE012550) (392 aa) fasta FT scores: E(): 2.2e-47, 40.56% id in 392 aa" FT /locus_tag="BPSS0129" FT /class="6.5.0" FT /colour=9 FT /product="putative transcriptional regulator" FT misc_feature 166869..166949 FT /note="Pfam match to entry PF02954 HTH_8, Bacterial FT regulatory protein, Fis family , score 26.5, E-value FT 8.2e-07" FT /colour=9 FT misc_feature 166878..166943 FT /note="Predicted helix-turn-helix motif with score FT 1256.000, SD 3.46 at aa 368-389, sequence FT GHPSATAQALGIHRNTLDYRLQ" FT /colour=2 FT CDS 168157..170964 FT /note="Similar in its full length to Ralstonia FT solanacearum putative peptide synthase protein rsp1419 or FT rs03122 SWALL:Q8XQ67 (EMBL:AL646084) (937 aa) fasta FT scores: E(): 0, 61.11% id in 936 aa, and in its N-terminal FT region to Bacillus subtilis putative polyketide synthase FT PksJ SWALL:PKSJ_BACSU (SWALL:P40806) (557 aa) fasta FT scores: E(): 8.8e-64, 35.95% id in 534 aa" FT /locus_tag="BPSS0130" FT /colour=7 FT /product="putative peptide synthase protein" FT /class="3.8.0" FT misc_feature 168319..169566 FT /note="Pfam match to entry PF00501 AMP-binding, FT AMP-binding enzyme , score 288.3, E-value 6.1e-84" FT /colour=9 FT misc_feature 168682..168717 FT /colour=8 FT /note="PS00455 Putative AMP-binding domain signature." FT misc_feature 169894..170097 FT /note="Pfam match to entry PF00550 pp-binding, FT Phosphopantetheine attachment site , score 40.8, E-value FT 2e-09" FT /colour=9 FT misc_feature 170167..170937 FT /note="Pfam match to entry PF00975 Thioesterase, FT Thioesterase domain , score 82.5, E-value 5.6e-22" FT /colour=9 FT CDS 170998..171984 FT /note="Similar to Rhizobium meliloti putative epimerase FT dehydratase, red superfamily, possibly UDP-glucose FT 4-epimerase protein rb0631 or smb21052 SWALL:Q92VR8 FT (EMBL:AL603644) (321 aa) fasta scores: E(): 1.5e-08, FT 26.68% id in 311 aa, and to Streptomyces avermitilis FT dtdp-glucose 4,6-dehydratase AveBII SWALL:Q9S0P5 FT (EMBL:AB032523) (355 aa) fasta scores: E(): 1.1e-07, FT 25.76% id in 260 aa" FT /locus_tag="BPSS0131" FT /class="7.0.0" FT /colour=13 FT /product="putative dehydratase" FT CDS 172008..172403 FT /note="Similar to Rhizobium loti hypothetical protein FT mlr5282 SWALL:Q98C61 (EMBL:AP003006) (148 aa) fasta FT scores: E(): 6.3e-06, 29.45% id in 129 aa" FT /locus_tag="BPSS0132" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS 172666..173691 FT /note="Similar to Actinomadura hibisca ORF6 SWALL:O32456 FT (EMBL:D87924) (341 aa) fasta scores: E(): 3e-36, 36.73% id FT in 343 aa, and to Streptomyces lipmanii FT O-demethylpuromycin-O-methyltransferase DmpM FT SWALL:DMPM_STRLP (SWALL:P42712) (376 aa) fasta scores: FT E(): 7.8e-32, 35.65% id in 331 aa" FT /locus_tag="BPSS0133" FT /class="7.0.0" FT /colour=13 FT /product="putative methyltransferase" FT misc_feature 172891..173616 FT /note="Pfam match to entry PF00891 Methyltransf_2, FT O-methyltransferase , score 203.3, E-value 2.4e-58" FT /colour=9 FT CDS complement(173732..174673) FT /note="Similar to Escherichia coli, Escherichia coli O6, FT and Escherichia coli O157:H7 glycine cleavage system FT transcriptional activator GcvA or b2808 or c3378 or z4125 FT or ecs3668 SWALL:GCVA_ECOLI (SWALL:P32064) (305 aa) fasta FT scores: E(): 1e-25, 34.23% id in 295 aa, and to FT Pseudomonas putida transcriptional regulator, putative FT pp1393 SWALL:AAN67016 (EMBL:AE016779) (291 aa) fasta FT scores: E(): 7.9e-30, 38.88% id in 288 aa. Note: This CDS FT is longer in its N-terminal region than most of its FT database matches, lacks an appropriate translational start FT codon. Possible pseudogene" FT /locus_tag="BPSS0134" FT /class="6.3.6" FT /colour=9 FT /product="putative LysR-family transcriptional regulator" FT misc_feature complement(173741..174352) FT /note="Pfam match to entry PF03466 LysR_substrate, LysR FT substrate binding domain , score 106.9, E-value 2.6e-29" FT /colour=9 FT misc_feature complement(174410..174589) FT /note="Pfam match to entry PF00126 HTH_1, Bacterial FT regulatory helix-turn-helix protein, lysR family , score FT 79.2, E-value 5.6e-21" FT /colour=9 FT misc_feature complement(174455..174547) FT /colour=8 FT /note="PS00044 Bacterial regulatory proteins, lysR family FT signature." FT misc_feature complement(174485..174550) FT /note="Predicted helix-turn-helix motif with score FT 1665.000, SD 4.86 at aa 42-63, sequence FT GSLSKAAAHLCRTQGAVSRQIQ" FT /colour=2 FT CDS 174740..175159 FT /note="Similar to Ralstonia solanacearum hypothetical FT protein rsp1479 or rs03064 SWALL:Q8XQ07 (EMBL:AL646085) FT (150 aa) fasta scores: E(): 2e-17, 45.86% id in 133 aa" FT /locus_tag="BPSS0135" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS complement(175204..176592) FT /note="Similar in its full length to Ralstonia FT solanacearum probable transmembrane protein rsc3143 or FT rs00460 SWALL:Q8XUP3 (EMBL:AL646073) (459 aa) fasta FT scores: E(): 1e-97, 58.48% id in 448 aa, and to FT Bradyrhizobium japonicum two-component hybrid sensor and FT regulator blr5677 SWALL:BAC50942 (EMBL:AP005955) (941 aa) FT fasta scores: E(): 1.7e-17, 32.38% id in 315 aa" FT /locus_tag="BPSS0136" FT /class="4.1.1" FT /colour=3 FT /product="putative membrane protein" FT misc_feature complement(175252..175743) FT /note="Pfam match to entry PF00990 GGDEF, GGDEF domain , FT score 223.3, E-value 2.3e-64" FT /colour=9 FT misc_feature complement(order(175759..175827,175870..175938,175957..176025,176083..176151,176188..176247,176290..176358,176395..176463,176491..176559)) FT /colour=0 FT /note="8 probable transmembrane helices predicted for FT BPSS0136 by TMHMM2.0 at aa 12-34, 44-66, 79-101, 116-135, FT 148-170, 190-212, 219-241 and 256-278" FT CDS 177878..178165 FT /locus_tag="BPSS0137" FT /class="4.1.0" FT /colour=3 FT /note="No significant database matches" FT /product="putative exported protein" FT misc_feature 177878..177952 FT /note="Signal peptide predicted for BPSS0137 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 1.000 between residues 46 and 47" FT /colour=3 FT CDS 178341..178646 FT /locus_tag="BPSS0138" FT /class="4.1.1" FT /colour=3 FT /note="No significant database matches. Possible FT alternative translational start site " FT /product="putative membrane protein" FT misc_feature 178548..178616 FT /colour=0 FT /note="1 probable transmembrane helix predicted for FT BPSS0138 by TMHMM2.0 at aa 29-51" FT CDS 179358..180737 FT /note="Similar to Ralstonia solanacearum hypothetical FT protein rsp1380 or rs02078 SWALL:Q8XQA6 (EMBL:AL646084) FT (459 aa) fasta scores: E(): 1.4e-148, 84.9% id in 457 aa, FT and to Streptomyces lividans mercuric reductase MerA FT SWALL:MERA_STRLI (SWALL:P30341) (474 aa) fasta scores: FT E(): 3.7e-43, 35.85% id in 449 aa" FT /locus_tag="BPSS0139" FT /class="7.0.0" FT /colour=13 FT /product="putative pyridine nucleotide-disulphide FT oxidoreductase" FT misc_feature 179373..180311 FT /note="Pfam match to entry PF00070 pyr_redox, Pyridine FT nucleotide-disulphide oxidoreductase , score 232.8, FT E-value 3.1e-67" FT /colour=9 FT misc_feature 179472..179504 FT /colour=8 FT /note="PS00076 Pyridine nucleotide-disulphide FT oxidoreductases class-I active site." FT misc_feature 180384..180713 FT /note="Pfam match to entry PF02852 pyr_redox_dim, Pyridine FT nucleotide-disulphide oxidoreductase, dimerisation domain FT , score 91.8, E-value 8.9e-25" FT /colour=9 FT CDS complement(180870..181817) FT /note="Similar to Escherichia coli O157:H7 putative FT periplasmic ribose-binding protein of ABC transport system FT z5689 or ecs5071 SWALL:Q8X5Q6 (EMBL:AE005642) (313 aa) FT fasta scores: E(): 3.9e-54, 54.27% id in 304 aa, and to FT Bacillus subtilis D-ribose-binding protein precursor RbsB FT SWALL:RBSB_BACSU (SWALL:P36949) (305 aa) fasta scores: FT E(): 1.6e-17, 31.31% id in 281 aa" FT /locus_tag="BPSS0140" FT /class="1.5.3" FT /colour=3 FT /product="putative sugar ABC transport system, FT lipoprotein" FT misc_feature complement(180891..181727) FT /note="Pfam match to entry PF00532 Peripla_BP_like, FT Periplasmic binding proteins and sugar binding domain of FT the LacI family , score -4.6, E-value 3e-05" FT /colour=9 FT misc_feature complement(181740..181817) FT /note="Signal peptide predicted for BPSS0140 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 1.000 between residues 26 and 27" FT /colour=3 FT misc_feature complement(181752..181784) FT /colour=8 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site." FT CDS complement(181894..182928) FT /note="Similar to Escherichia coli, Escherichia coli O6, FT and Escherichia coli O157:H7 ribose transport system FT permease protein RbsC or b3750 or c4678 or z5251 or FT ecs4692 SWALL:RBSC_ECOLI (SWALL:P04984) (321 aa) fasta FT scores: E(): 6e-36, 45.48% id in 310 aa, and to Yersinia FT pestis sugar transport system permease protein ypo3963 or FT y3866 SWALL:Q8ZA55 (EMBL:AJ414160) (330 aa) fasta scores: FT E(): 2.3e-62, 60.67% id in 328 aa" FT /locus_tag="BPSS0141" FT /class="1.5.3" FT /colour=3 FT /product="putative sugar ABC transport system, membrane FT protein" FT misc_feature complement(181912..182763) FT /note="Pfam match to entry PF02653 BPD_transp_2, FT Branched-chain amino acid transport system / permease FT component , score -20.3, E-value 9.1e-06" FT /colour=9 FT misc_feature complement(order(181933..182001,182014..182109,182152..182220,182311..182379,182437..182490,182503..182571,182581..182649,182662..182730,182758..182826)) FT /colour=0 FT /note="9 probable transmembrane helices predicted for FT BPSS0141 by TMHMM2.0 at aa 35-57, 67-89, 94-116, 120-142, FT 147-164, 184-206, 237-259, 274-305 and 310-332" FT CDS complement(182971..184524) FT /note="Similar to Escherichia coli ribose transport FT ATP-binding protein RbsA or b3749 SWALL:RBSA_ECOLI FT (SWALL:P04983) (501 aa) fasta scores: E(): 1.2e-71, 45.4% FT id in 500 aa, and to Yersinia pestis sugar transport FT ATP-binding protein ypo3964 or y3865 SWALL:Q8ZA54 FT (EMBL:AJ414160) (507 aa) fasta scores: E(): 1.2e-90, FT 59.28% id in 501 aa" FT /locus_tag="BPSS0142" FT /class="1.5.3" FT /colour=3 FT /product="putative sugar ABC transport system, ATP-binding FT protein" FT misc_feature complement(183076..183654) FT /note="Pfam match to entry PF00005 ABC_tran, ABC FT transporter , score 109.1, E-value 5.6e-30" FT /colour=9 FT misc_feature complement(183259..183303) FT /colour=8 FT /note="PS00211 ABC transporters family signature." FT misc_feature complement(183844..184419) FT /note="Pfam match to entry PF00005 ABC_tran, ABC FT transporter , score 189.9, E-value 2.7e-54" FT /colour=9 FT misc_feature complement(184375..184398) FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT CDS complement(184511..185761) FT /note="Similar to Rhizobium meliloti putative FT transcription regulator protein r00475 or smc02172 FT SWALL:Q92SC9 (EMBL:AL591783) (409 aa) fasta scores: E(): FT 1.3e-34, 33.42% id in 386 aa, and to Agrobacterium FT tumefaciens transcriptional regulator, ROK family atu4655 FT or agr_l_455 SWALL:Q8U701 (EMBL:AE009394) (429 aa) fasta FT scores: E(): 2.9e-28, 31.93% id in 404 aa" FT /locus_tag="BPSS0143" FT /class="6.3.9" FT /colour=9 FT /product="putative ROK family transcriptional regulator" FT misc_feature complement(184928..185491) FT /note="Pfam match to entry PF00480 ROK, ROK family , score FT 23.7, E-value 2.8e-08" FT /colour=9 FT misc_feature complement(185600..185665) FT /note="Predicted helix-turn-helix motif with score FT 998.000, SD 2.59 at aa 33-54, sequence FT ASKADLARLANLTGTAVGSIIA" FT /colour=2 FT CDS complement(186668..189283) FT /note="N-terminal region similar to Clostridium sp. FT glucoamylase precursor Cga SWALL:AMYG_CLOSP (SWALL:P29761) FT (702 aa) fasta scores: E(): 8.9e-20, 37.14% id in 743 aa, FT and C-terminal end to Streptomyces violaceus alpha-amylase FT precursor Aml SWALL:AMY_STRVL (SWALL:P22998) (569 aa) FT fasta scores: E(): 7.5e-13, 37.8% id in 164 aa" FT /locus_tag="BPSS0144" FT /class="2.1.3" FT /colour=5 FT /product="putative amylase" FT misc_feature complement(186683..186964) FT /note="Pfam match to entry PF00686 CBM_20, Starch binding FT domain , score 118.9, E-value 6.2e-33" FT /colour=9 FT misc_feature complement(188459..188506) FT /colour=8 FT /note="PS00453 FKBP-type peptidyl-prolyl cis-trans FT isomerase signature 1." FT misc_feature complement(189218..189283) FT /note="Signal peptide predicted for BPSS0144 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.422 between residues 22 and 23" FT /colour=3 FT CDS complement(190115..191512) FT /note="Similar to Escherichia coli ATP-independent RNA FT helicase DbpA or b1343 SWALL:DBPA_ECOLI (SWALL:P21693) FT (457 aa) fasta scores: E(): 3.1e-84, 55.02% id in 458 aa, FT and to Pseudomonas aeruginosa RNA helicase pa0455 FT SWALL:Q9I663 (EMBL:AE004483) (458 aa) fasta scores: E(): FT 2.4e-109, 64.62% id in 458 aa" FT /product="ATP-independent RNA helicase" FT /gene="dbpA" FT /locus_tag="BPSS0145" FT /class="2.2.11" FT /colour=2 FT misc_feature complement(190121..190378) FT /note="Pfam match to entry PF03880 DbpA, DbpA RNA binding FT domain , score 108.4, E-value 9e-30" FT /colour=9 FT misc_feature complement(190490..190705) FT /note="Pfam match to entry PF00271 helicase_C, Helicase FT conserved C-terminal domain , score 108.5, E-value FT 8.5e-30" FT /colour=9 FT misc_feature complement(190841..191452) FT /note="Pfam match to entry PF00270 DEAD, DEAD/DEAH box FT helicase , score 265.3, E-value 5.4e-77" FT /colour=9 FT misc_feature complement(191021..191047) FT /colour=8 FT /note="PS00039 DEAD-box subfamily ATP-dependent helicases FT signature." FT misc_feature complement(191060..191086) FT /colour=8 FT /note="PS01070 DNA/RNA non-specific endonucleases active FT site." FT misc_feature complement(191336..191359) FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT CDS complement(191677..192306) FT /note="Similar to the C-terminal region of Ralstonia FT solanacearum probable porin signal peptide protein rsp0051 FT or rs02026 SWALL:Q8XTQ5 (EMBL:AL646076) (382 aa) fasta FT scores: E(): 2.3e-23, 38.64% id in 207 aa, and of FT Acinetobacter lwoffii hypothetical 36.5 kDa protein FT SWALL:Q934S0 (EMBL:U77658) (344 aa) fasta scores: E(): FT 1e-06, 26.22% id in 225 aa" FT /locus_tag="BPSS0146" FT /class="0.0.0" FT /colour=8 FT /product="hypothetical protein" FT CDS complement(192341..193654) FT /note="Similar to Klebsiella pneumoniae citrate-proton FT symporter CitH or Cit SWALL:CIT1_KLEPN (SWALL:P16482) (444 FT aa) fasta scores: E(): 4.8e-44, 37.05% id in 421 aa, and FT to the plasmid borne Escherichia coli citrate-proton FT symporter CitA or Cit SWALL:CIT1_ECOLI (SWALL:P07661) (431 FT aa) fasta scores: E(): 3.7e-41, 35.84% id in 399 aa" FT /locus_tag="BPSS0147" FT /class="1.5.0" FT /colour=3 FT /product="putative transporter protein" FT misc_feature complement(192359..193585) FT /note="Pfam match to entry PF00083 sugar_tr, Sugar (and FT other) transporter , score 80.2, E-value 2.8e-21" FT /colour=9 FT misc_feature complement(order(192371..192424,192452..192520,192557..192625,192653..192709,192743..192811,192839..192907,193010..193063,193076..193144,193205..193273,193286..193354,193391..193459,193517..193585)) FT /colour=0 FT /note="12 probable transmembrane helices predicted for FT BPSS0147 by TMHMM2.0 at aa 46-68, 88-110, 123-145, FT 150-172, 193-215, 220-237, 272-294, 304-326, 338-356, FT 366-388, 401-423 and 433-450" FT misc_feature complement(193178..193255) FT /colour=8 FT /note="PS00217 Sugar transport proteins signature 2." FT misc_feature complement(193355..193405) FT /colour=8 FT /note="PS00216 Sugar transport proteins signature 1." FT CDS complement(193695..194885) FT /note="Similar to Campylobacter jejuni hippurate hydrolase FT HipO or cj0985C SWALL:HIPO_CAMJE (SWALL:P45493) (383 aa) FT fasta scores: E(): 2.3e-64, 47.53% id in 385 aa, and to FT Pseudomonas aeruginosa probable hydrolase pa4344 FT SWALL:Q9HW57 (EMBL:AE004850) (406 aa) fasta scores: E(): FT 1.3e-86, 59.17% id in 387 aa" FT /locus_tag="BPSS0148" FT /class="7.0.0" FT /colour=13 FT /product="subfamily M20D non-peptidase homologue" FT misc_feature complement(193881..194834) FT /note="Pfam match to entry PF01546 Peptidase_M20, FT Peptidase family M20/M25/M40 , score 291.7, E-value FT 5.8e-85" FT /colour=9 FT CDS 195065..195967 FT /note="Similar to Comamonas testosteroni TsaR SWALL:P94678 FT (EMBL:U32622) (298 aa) fasta scores: E(): 2.3e-35, 37.79% FT id in 299 aa, and to Escherichia coli putative FT transcriptional regulator AbgR or b1339 SWALL:ABGR_ECOLI FT (SWALL:P77744) (302 aa) fasta scores: E(): 7e-28, 32.64% FT id in 291 aa" FT /locus_tag="BPSS0149" FT /class="6.3.6" FT /colour=9 FT /product="LysR-family transcriptional regulator" FT misc_feature 195071..195250 FT /note="Pfam match to entry PF00126 HTH_1, Bacterial FT regulatory helix-turn-helix protein, lysR family , score FT 90.5, E-value 2.2e-24" FT /colour=9 FT misc_feature 195110..195175 FT /note="Predicted helix-turn-helix motif with score FT 1745.000, SD 5.13 at aa 16-37, sequence FT GSIRAAARRLNVSPAALTKAVK" FT /colour=2 FT misc_feature 195113..195205 FT /colour=8 FT /note="PS00044 Bacterial regulatory proteins, lysR family FT signature." FT misc_feature 195320..195949 FT /note="Pfam match to entry PF03466 LysR_substrate, LysR FT substrate binding domain , score 123.7, E-value 2.2e-34" FT /colour=9 FT misc_feature 195677..195697 FT /colour=8 FT /note="PS00290 Immunoglobulins and major FT histocompatibility complex proteins signature." FT CDS complement(196307..197116) FT /note="Low similarity to Pseudomonas aeruginosa FT hypothetical protein pa5101 SWALL:Q9HU82 (EMBL:AE004923) FT (265 aa) fasta scores: E(): 5.2e-20, 36.07% id in 219 aa, FT and to Rhizobium loti hypothetical protein mll1215 FT SWALL:Q98L21 (EMBL:AP002996) (275 aa) fasta scores: E(): FT 2.2e-08, 34.57% id in 214 aa" FT /locus_tag="BPSS0150" FT /class="0.0.0" FT /colour=8 FT /product="hypothetical protein" FT CDS 197293..198459 FT /note="Similar to Pseudomonas aeruginosa hypothetical FT protein pa5102 SWALL:Q9HU81 (EMBL:AE004923) (312 aa) fasta FT scores: E(): 1.8e-58, 49.21% id in 317 aa, and to FT Burkholderia cepacia putative omega-3 fatty acid FT desaturase SWALL:Q9ZGQ3 (EMBL:AF076477) (334 aa) fasta FT scores: E(): 8.2e-05, 28.78% id in 264 aa. Note: CDS is FT longer in its N-terminal region than most of its database FT matches, possible alternative start codon at residue 51" FT /locus_tag="BPSS0151" FT /class="7.0.0" FT /colour=13 FT /product="putative desaturase" FT misc_feature 197503..197571 FT /colour=0 FT /note="1 probable transmembrane helix predicted for FT BPSS0151 by TMHMM2.0 at aa 107-129" FT misc_feature 197584..198264 FT /note="Pfam match to entry PF00487 FA_desaturase, Fatty FT acid desaturase , score 20.6, E-value 3.6e-07" FT /colour=9 FT CDS 198951..199391 FT /note="Similar to Ralstonia solanacearum putative FT transmembrane protein rsc3150 or rs00450 SWALL:Q8XUN7 FT (EMBL:AL646073) (143 aa) fasta scores: E(): 3e-25, 72.26% FT id in 137 aa, and to Pseudomonas aeruginosa hypothetical FT protein pa5183 SWALL:Q9HU06 (EMBL:AE004931) (135 aa) fasta FT scores: E(): 2.7e-13, 47.94% id in 146 aa" FT /locus_tag="BPSS0152" FT /class="4.1.1" FT /colour=3 FT /product="putative membrane protein" FT misc_feature 198951..199022 FT /note="Signal peptide predicted for BPSS0152 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.999 between residues 24 and 25" FT /colour=3 FT misc_feature order(198963..199025,199068..199136,199173..199241,199254..199307) FT /colour=0 FT /note="4 probable transmembrane helices predicted for FT BPSS0152 by TMHMM2.0 at aa 5-25, 40-62, 75-97 and 102-119" FT CDS complement(199973..200872) FT /note="Similar to Escherichia coli glutamate/aspartate FT periplasmic binding protein precursor GltI or b0655 FT SWALL:GLTI_ECOLI (SWALL:P37902) (302 aa) fasta scores: FT E(): 1.8e-60, 55% id in 300 aa, and to Ralstonia FT solanacearum probable amino-acid-binding periplasmic FT rsc0481 or rs04394 SWALL:Q8Y255 (EMBL:AL646059) (313 aa) FT fasta scores: E(): 1.8e-64, 59.37% id in 288 aa" FT /product="glutamate/aspartate periplasmic binding protein FT precursor" FT /gene="gltI" FT /locus_tag="BPSS0153" FT /class="1.5.1" FT /colour=3 FT misc_feature complement(200066..200758) FT /note="Pfam match to entry PF00497 SBP_bac_3, Bacterial FT extracellular solute-binding proteins, family 3 , score FT 202.5, E-value 4.4e-58" FT /colour=9 FT misc_feature complement(200804..200872) FT /note="Signal peptide predicted for BPSS0153 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.993 between residues 23 and 24" FT /colour=3 FT CDS complement(201036..202283) FT /note="Similar to Escherichia coli, Escherichia coli O6, FT and Escherichia coli O157:H7 D-amino acid dehydrogenase FT small subunit DadA or DadR or b1189 or c1638 or z1952 or FT ecs1684 SWALL:DADA_ECOLI (SWALL:P29011) (432 aa) fasta FT scores: E(): 5.6e-51, 37.85% id in 420 aa, and to FT Pseudomonas aeruginosa D-amino acid dehydrogenase 2 small FT subunit pa5084 SWALL:DAD2_PSEAE (SWALL:Q9HU99) (416 aa) FT fasta scores: E(): 1e-68, 51.44% id in 414 aa" FT /product="putative D-amino acid dehydrogenase small FT subunit" FT /EC_number="1.4.99.1" FT /gene="dadA" FT /gene="dadR" FT /locus_tag="BPSS0154" FT /class="3.4.2" FT /colour=6 FT misc_feature complement(202200..202283) FT /note="Pfam match to entry PF03721 UDPG_MGDP_dh_N, FT UDP-glucose/GDP-mannose dehydrogenase family, NAD binding FT domain , score 31.7, E-value 4.2e-08" FT /colour=9 FT misc_feature complement(202224..202283) FT /note="Signal peptide predicted for BPSS0154 by SignalP FT 2.0 HMM (Signal peptide probability 0.984) with cleavage FT site probability 0.975 between residues 20 and 21" FT /colour=3 FT CDS complement(202436..203368) FT /note="Similar to Escherichia coli transcriptional FT activator protein LysR or b2839 SWALL:LYSR_ECOLI FT (SWALL:P03030) (311 aa) fasta scores: E(): 1.7e-16, 34.95% FT id in 246 aa, and to Pseudomonas aeruginosa probable FT transcriptional regulator pa5085 SWALL:Q9HU98 FT (EMBL:AE004921) (318 aa) fasta scores: E(): 1.7e-30, FT 41.58% id in 291 aa" FT /locus_tag="BPSS0155" FT /class="6.3.6" FT /colour=9 FT /product="putative LysR-family transcriptional regulator" FT misc_feature complement(202499..203113) FT /note="Pfam match to entry PF03466 LysR_substrate, LysR FT substrate binding domain , score 100.5, E-value 2.1e-27" FT /colour=9 FT misc_feature complement(203183..203362) FT /note="Pfam match to entry PF00126 HTH_1, Bacterial FT regulatory helix-turn-helix protein, lysR family , score FT 77.4, E-value 1.9e-20" FT /colour=9 FT misc_feature complement(203258..203323) FT /note="Predicted helix-turn-helix motif with score FT 2048.000, SD 6.16 at aa 16-37, sequence FT GSLSKAAQLLCVSQPAVSKVLA" FT /colour=2 FT CDS complement(203913..204674) FT /note="Similar to Ralstonia solanacearum probable FT dehydrogenase/reductase oxidoreductase protein rsc1029 or FT rs04221 SWALL:Q8Y0L4 (EMBL:AL646062) (246 aa) fasta FT scores: E(): 6.8e-24, 39.5% id in 243 aa, and to Bacillus FT cereus benzil reductase YueD SWALL:Q8RJ14 (EMBL:AB052927) FT (249 aa) fasta scores: E(): 1.8e-19, 34.04% id in 235 aa" FT /locus_tag="BPSS0156" FT /class="7.0.0" FT /colour=13 FT /product="putative dehydrogenase" FT misc_feature complement(203922..204650) FT /note="Pfam match to entry PF00106 adh_short, short chain FT dehydrogenase , score 42.1, E-value 5e-10" FT /colour=9 FT CDS 205043..205462 FT /locus_tag="BPSS0157" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS 205904..207820 FT /note="Very low similarity to Anabaena sp. hypothetical FT protein all2038 SWALL:Q8YVE0 (EMBL:AP003588) (743 aa) FT fasta scores: E(): 1.3e-16, 30.72% id in 677 aa, and in FT its C-terminal region to Anabaena sp. hypothetical protein FT all3696 SWALL:Q8YQW5 (EMBL:AP003594) (379 aa) fasta FT scores: E(): 2.1e-06, 27.71% id in 368 aa" FT /locus_tag="BPSS0158" FT /class="4.1.0" FT /colour=3 FT /product="putative exported protein" FT misc_feature 205904..205975 FT /note="Signal peptide predicted for BPSS0158 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.995 between residues 59 and 60" FT /colour=3 FT misc_feature 206114..206137 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT CDS 208096..210993 FT /note="Similar to Xanthomonas campestris hypothetical FT protein xcc2894 SWALL:Q8P6S1 (EMBL:AE012403) (781 aa) FT fasta scores: E(): 2.6e-40, 34.17% id in 793 aa, and to FT Mycobacterium tuberculosis hypothetical protein rv0584 or FT mt0612 or mtv039.22 SWALL:O86365 (EMBL:AL021942) (877 aa) FT fasta scores: E(): 4.7e-37, 38.47% id in 850 aa" FT /locus_tag="BPSS0159" FT /class="4.1.0" FT /colour=3 FT /product="putative exported protein" FT misc_feature 208096..208236 FT /note="Signal peptide predicted for BPSS0159 by SignalP FT 2.0 HMM (Signal peptide probability 0.943) with cleavage FT site probability 0.438 between residues 19 and 20" FT /colour=3 FT misc_feature 210556..210585 FT /colour=8 FT /note="PS00178 Aminoacyl-transfer RNA synthetases class-I FT signature." FT CDS 211595..212653 FT /note="Similar to Pseudomonas aeruginosa pyoverdine FT biosynthesis protein PvcA or pa2254 SWALL:Q9I1L5 FT (EMBL:AE004651) (328 aa) fasta scores: E(): 1.5e-74, FT 61.16% id in 309 aa, and to the N-terminal region of FT Vibrio cholerae PvcA protein vc1949 SWALL:Q9KQP9 FT (EMBL:AE004270) (608 aa) fasta scores: E(): 1.3e-13, FT 30.45% id in 243 aa" FT /locus_tag="BPSS0160" FT /class="1.6.3" FT /colour=0 FT /product="putative siderophore biosynthesis-related FT protein" FT CDS 212650..213564 FT /note="Similar to Pseudomonas aeruginosa pyoverdine FT biosynthesis protein PvcB or pa2255 SWALL:Q9I1L4 FT (EMBL:AE004651) (291 aa) fasta scores: E(): 4.4e-76, FT 61.03% id in 290 aa, and to Vibrio cholerae PvcB protein FT vc1944 SWALL:Q9KQQ4 (EMBL:AE004270) (287 aa) fasta scores: FT E(): 1.1e-54, 48.86% id in 264 aa" FT /locus_tag="BPSS0161" FT /class="1.6.3" FT /colour=0 FT /product="putative siderophore biosynthesis-related FT protein" FT CDS 213569..215074 FT /note="Similar to Pseudomonas aeruginosa pyoverdin FT chromophore biosynthetic protein PvcC or pa2256 FT SWALL:PVCC_PSEAE (SWALL:O30372) (500 aa) fasta scores: FT E(): 2.2e-156, 76.17% id in 491 aa, and to Escherichia FT coli 4-hydroxyphenylacetate 3-monooxygenase, oxygenase FT component HpaB SWALL:HPAB_ECOLI (SWALL:Q57160) (520 aa) FT fasta scores: E(): 2.5e-81, 43.84% id in 504 aa" FT /product="putative siderophore biosynthesis-related FT protein" FT /locus_tag="BPSS0162" FT /class="1.6.3" FT /colour=0 FT misc_feature 213902..215017 FT /note="Pfam match to entry PF03241 HpaB, FT 4-hydroxyphenylacetate 3-hydroxylase family , score 598.7, FT E-value 2.3e-177" FT /colour=9 FT CDS 215120..216988 FT /note="Similar to Bacillus subtilis asparagine synthetase FT [glutamine-hydrolyzing] 3 AsnO SWALL:ASNO_BACSU FT (SWALL:O05272) (614 aa) fasta scores: E(): 1.6e-68, 42.01% FT id in 626 aa, and to Streptomyces aureofaciens asparagine FT synthase homolog TcsG SWALL:Q9FAR2 (EMBL:AB039379) (609 FT aa) fasta scores: E(): 2.6e-128, 54.76% id in 619 aa" FT /product="asparagine synthetase [glutamine-hydrolyzing]" FT /EC_number="6.3.5.4" FT /gene="asnO" FT /locus_tag="BPSS0163" FT /class="3.1.3" FT /colour=7 FT misc_feature 215123..215587 FT /note="Pfam match to entry PF00310 GATase_2, Glutamine FT amidotransferases class-II , score 52.0, E-value 8.3e-13" FT /colour=9 FT misc_feature 215786..216829 FT /note="Pfam match to entry PF00733 Asn_synthase, FT Asparagine synthase , score 109.8, E-value 3.5e-30" FT /colour=9 FT CDS 217017..217988 FT /note="Similar to Mycobacterium tuberculosis quinone FT oxidoreductase rv1454c or mt1501 or mtv007.01C FT SWALL:O53146 (EMBL:AL021184) (335 aa) fasta scores: E(): FT 2.6e-54, 54.1% id in 329 aa, and to Pseudomonas aeruginosa FT quinone oxidoreductase Qor or pa0023 SWALL:QOR_PSEAE FT (SWALL:P43903) (325 aa) fasta scores: E(): 3.4e-42, 46.27% FT id in 322 aa" FT /locus_tag="BPSS0164" FT /class="3.5.3" FT /colour=1 FT /product="putative quinone oxidoreductase" FT misc_feature 217041..217985 FT /note="Pfam match to entry PF00107 adh_zinc, Zinc-binding FT dehydrogenase , score 272.7, E-value 3.1e-79" FT /colour=9 FT misc_feature 217428..217493 FT /colour=8 FT /note="PS01162 Quinone oxidoreductase / zeta-crystallin FT signature." FT CDS 218043..218969 FT /note="Similar to Salmonella typhi FT 3,4-dihydroxyphenylacetate 2,3-dioxygenase sty1137 FT SWALL:Q8Z7Q1 (EMBL:AL627269) (283 aa) fasta scores: E(): FT 6.7e-18, 29.21% id in 291 aa, and to Escherichia coli FT 3,4-dihydroxyphenylacetate 2,3-dioxygenase HpcB FT SWALL:HPCB_ECOLI (SWALL:Q05353) (275 aa) fasta scores: FT E(): 4.2e-16, 28.95% id in 259 aa" FT /locus_tag="BPSS0165" FT /class="3.4.3" FT /colour=6 FT /product="putative dioxygenase" FT misc_feature 218196..218600 FT /note="Pfam match to entry PF02900 LigB, Catalytic LigB FT subunit of aromatic ring-opening dioxygenase , score 38.2, FT E-value 3.8e-11" FT /colour=9 FT CDS complement(219213..220175) FT /note="Similar to Pseudomonas aeruginosa transcriptional FT regulator for exotoxin A production PtxR or pa2258 FT SWALL:PTXR_PSEAE (SWALL:P72131) (312 aa) fasta scores: FT E(): 1.3e-42, 42.06% id in 290 aa, and to Salmonella typhi FT possible LysR-family transcriptional regulator sty3037 FT SWALL:Q8Z482 (EMBL:AL627276) (310 aa) fasta scores: E(): FT 4.1e-25, 30.84% id in 308 aa" FT /locus_tag="BPSS0166" FT /class="6.3.6" FT /colour=9 FT /product="LysR family regulatory protein" FT misc_feature complement(219258..219878) FT /note="Pfam match to entry PF03466 LysR_substrate, LysR FT substrate binding domain , score 129.8, E-value 3.3e-36" FT /colour=9 FT misc_feature complement(219948..220127) FT /note="Pfam match to entry PF00126 HTH_1, Bacterial FT regulatory helix-turn-helix protein, lysR family , score FT 82.7, E-value 4.9e-22" FT /colour=9 FT misc_feature complement(220023..220088) FT /note="Predicted helix-turn-helix motif with score FT 1341.000, SD 3.75 at aa 30-51, sequence FT GSFTAAAECLSMSKSLVSEYLS" FT /colour=2 FT CDS complement(221397..225473) FT /note="Similar to Salmonella enterica subsp. enterica FT serovar Typhimurium SciS protein precursor SWALL:Q93IR7 FT (EMBL:AJ320483) (1289 aa) fasta scores: E(): 2.4e-141, FT 45.3% id in 1351 aa, and to Yersinia pestis putative FT membrane protein ypo2724 SWALL:Q8ZD68 (EMBL:AJ414153) FT (1275 aa) fasta scores: E(): 3.4e-48, 29.77% id in 1360 FT aa. Note: The amino acid residues between approx. position FT 255 and position 320 present no similarities to the FT database matches. Also similar to BPSS0103 (1303 aa) fasta FT scores: E(): 5.1e-92, 47.210% identity in 1362 aa overlap" FT /locus_tag="BPSS0167" FT /class="4.1.1" FT /colour=3 FT /product="putative membrane protein" FT misc_feature complement(order(223677..223745,225114..225173,225201..225269,225288..225356,225369..225437)) FT /colour=0 FT /note="5 probable transmembrane helices predicted for FT BPSS0167 by TMHMM2.0 at aa 13-35, 40-62, 69-91, 101-120 FT and 577-599" FT misc_feature complement(224838..224858) FT /colour=8 FT /note="PS00046 Histone H2A signature." FT misc_feature complement(224874..224897) FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT misc_feature complement(225366..225473) FT /note="Signal peptide predicted for BPSS0167 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.837 between residues 36 and 37" FT /colour=3 FT CDS complement(225502..226767) FT /note="Similar to Salmonella typhimurium, and Salmonella FT enterica subsp. enterica serovar Typhimurium putative FT outer membrane protein, OmpA family stm0282 or SciP FT SWALL:Q93IS0 (EMBL:AE008707) (434 aa) fasta scores: E(): FT 6.7e-63, 48.33% id in 391 aa, and to Pseudomonas FT aeruginosa hypothetical protein pa0078 SWALL:Q9I754 FT (EMBL:AE004447) (449 aa) fasta scores: E(): 1.3e-22, FT 37.44% id in 414 aa. Note: Also similar to BPSS0102 (434 FT aa) fasta scores: E(): 2.1e-55, 46.283% identity in 417 aa FT overlap" FT /locus_tag="BPSS0168" FT /class="4.1.1" FT /colour=3 FT /product="OmpA family membrane protein" FT misc_feature complement(225529..225825) FT /note="Pfam match to entry PF00691 OmpA, OmpA family , FT score 111.1, E-value 1.4e-30" FT /colour=9 FT misc_feature complement(226000..226068) FT /colour=0 FT /note="1 probable transmembrane helix predicted for FT BPSS0168 by TMHMM2.0 at aa 234-256" FT CDS complement(226856..228202) FT /note="Similar to Salmonella typhimurium, and Salmonella FT enterica subsp. enterica serovar Typhimurium putative FT cytoplasmic protein stm0281 or SciO SWALL:Q93IS1 FT (EMBL:AE008707) (447 aa) fasta scores: E(): 4.3e-107, FT 59.73% id in 447 aa, and to Yersinia pestis hypothetical FT protein ypo2934 or y1549 SWALL:Q8ZCP3 (EMBL:AJ414154) (449 FT aa) fasta scores: E(): 3.6e-97, 55.05% id in 445 aa. Note: FT Also similar to BPSS0101 (453 aa) fasta scores: E(): FT 4.5e-106, 62.054% identity in 448 aa overlap" FT /locus_tag="BPSS0169" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS complement(228224..228736) FT /note="Similar to Salmonella enterica subsp. enterica FT serovar Typhimurium SciN protein precursor SWALL:Q93IS2 FT (EMBL:AJ320483) (163 aa) fasta scores: E(): 2.9e-21, FT 46.25% id in 160 aa, and to Pseudomonas aeruginosa FT hypothetical protein pa1666 SWALL:Q9I359 (EMBL:AE004594) FT (168 aa) fasta scores: E(): 6.4e-13, 39.85% id in 138 aa. FT Note: Also similar to BPSS0100 (161 aa) fasta scores: E(): FT 2.9e-21, 45.860% identity in 157 aa overlap" FT /locus_tag="BPSS0170" FT /class="4.1.0" FT /colour=3 FT /product="putative lipoprotein" FT misc_feature complement(228659..228736) FT /note="Signal peptide predicted for BPSS0170 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.290 between residues 26 and 27" FT /colour=3 FT misc_feature complement(228680..228712) FT /colour=8 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site." FT CDS complement(228834..229319) FT /note="Similar to Salmonella typhimurium, and Salmonella FT enterica subsp. enterica serovar Typhimurium putative FT cytoplasmic protein stm0279 or SciM SWALL:Q93IS3 FT (EMBL:AE008707) (161 aa) fasta scores: E(): 2.9e-42, FT 68.12% id in 160 aa, and to Yersinia pestis hypothetical FT protein ypo2937 SWALL:Q8ZCP1 (EMBL:AJ414154) (161 aa) FT fasta scores: E(): 8.8e-37, 57.59% id in 158 aa. Note: FT Also similar to BPSS0099 (161 aa) fasta scores: E(): FT 4.1e-42, 66.456% identity in 158 aa overlap" FT /locus_tag="BPSS0171" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS complement(229436..230935) FT /note="Similar to Yersinia pestis hypothetical protein FT ypo2938 SWALL:Q8ZCP0 (EMBL:AJ414154) (500 aa) fasta FT scores: E(): 9.3e-166, 80.2% id in 500 aa, and to FT Salmonella enterica subsp. enterica serovar Typhimurium FT SciI protein SWALL:Q93IS7 (EMBL:AJ320483) (497 aa) fasta FT scores: E(): 4.6e-161, 78.49% id in 493 aa. Note: Also FT similar to BPSS0098 (500 aa) fasta scores: E(): 5.9e-182, FT 84.168% identity in 499 aa overlap" FT /locus_tag="BPSS0172" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT misc_feature complement(230048..230098) FT /colour=8 FT /note="PS00237 G-protein coupled receptors signature." FT CDS complement(230970..231551) FT /note="Similar to Yersinia pestis hypothetical protein FT ypo2939 SWALL:Q8ZCN9 (EMBL:AJ414154) (174 aa) fasta FT scores: E(): 1.8e-45, 78.31% id in 166 aa, and to FT Salmonella typhimurium, and Salmonella enterica subsp. FT enterica serovar Typhimurium putative cytoplasmic protein FT stm0273 or SciH SWALL:Q93IS8 (EMBL:AE008707) (180 aa) FT fasta scores: E(): 1.2e-44, 77.43% id in 164 aa. Note: FT This CDS is longer in its C-terminal region than most of FT its database matches and also similar to BPSS0097 (180 aa) FT fasta scores: E(): 4.5e-46, 81.818% identity in 165 aa FT overlap" FT /locus_tag="BPSS0173" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS complement(231587..234526) FT /note="Similar to Salmonella typhimurium, and Salmonella FT enterica subsp. enterica serovar Typhimurium putative FT ATPase with chaperone activity stm0272 or sciG FT SWALL:Q93IS9 (EMBL:AE008707) (879 aa) fasta scores: E(): FT 1.4e-75, 58.54% id in 948 aa, and to Yersinia FT enterocolitica Clp protease-associated protein ClpB FT SWALL:Q9F746 (EMBL:AF285784) (890 aa) fasta scores: E(): FT 1.7e-69, 55.59% id in 939 aa. Note: Also similar to FT BPSS1502 (1013 aa) fasta scores: E(): 1.8e-94, 44.865% FT identity in 1003 aa overlap" FT /locus_tag="BPSS0174" FT /class="1.3.1" FT /colour=0 FT /product="putative chaperone" FT misc_feature complement(232418..232441) FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT misc_feature complement(233324..233836) FT /note="Pfam match to entry PF00004 AAA, ATPase family FT associated with various cellular activities (AAA) , score FT 29.8, E-value 3.5e-07" FT /colour=9 FT misc_feature complement(233519..233557) FT /colour=8 FT /note="PS00870 Chaperonins clpA/B signature 1." FT misc_feature complement(233798..233821) FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT misc_feature complement(234173..234208) FT /colour=8 FT /note="PS00213 Lipocalin signature." FT CDS 235059..235778 FT /locus_tag="BPSS0175" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS 235775..236740 FT /note="Similar to Salmonella enterica subsp. enterica FT serovar Typhimurium SciE protein SWALL:Q93IT1 FT (EMBL:AJ320483) (279 aa) fasta scores: E(): 6.8e-24, FT 38.69% id in 292 aa, and to Pseudomonas aeruginosa FT hypothetical protein pa0086 SWALL:Q9I746 (EMBL:AE004447) FT (281 aa) fasta scores: E(): 8.4e-23, 37.5% id in 272 aa. FT Note: Also similar to BPSS0114 (285 aa) fasta scores: E(): FT 7.9e-24, 39.590% identity in 293 aa overlap" FT /locus_tag="BPSS0176" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS 236781..237308 FT /note="Similar to Salmonella typhimurium, and Salmonella FT enterica subsp. enterica serovar Typhimurium putative FT cytoplasmic protein stm0269 or SciD SWALL:Q93IT2 FT (EMBL:AE008707) (164 aa) fasta scores: E(): 6.7e-24, FT 48.12% id in 160 aa, and to Yersinia pestis hypothetical FT protein ypo2728 or y1561 SWALL:Q8ZD64 (EMBL:AJ414153) (159 FT aa) fasta scores: E(): 3e-21, 38.71% id in 155 aa. Note: FT Also similar to BPSS0113 (173 aa) fasta scores: E(): FT 3.8e-25, 45.912% identity in 159 aa overlap" FT /locus_tag="BPSS0177" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS 237339..239228 FT /note="Similar to Salmonella enterica subsp. enterica FT serovar Typhimurium SciC protein SWALL:Q93IT3 FT (EMBL:AJ320483) (627 aa) fasta scores: E(): 3.9e-156, FT 61.14% id in 628 aa, and to Yersinia pestis hypothetical FT protein ypo2947 or y1537 SWALL:Q8ZCN4 (EMBL:AJ414154) (626 FT aa) fasta scores: E(): 2.1e-143, 55.09% id in 628 aa. FT Note: Also similar to BPSS0112 (627 aa) fasta scores: E(): FT 1.2e-144, 63.796% identity in 627 aa overlap" FT /locus_tag="BPSS0178" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS 239240..240313 FT /note="Similar to Salmonella enterica subsp. enterica FT serovar Typhimurium SciB protein SWALL:Q93IT4 FT (EMBL:AJ320483) (291 aa) fasta scores: E(): 1.2e-65, FT 56.29% id in 286 aa, and to Yersinia pestis hypothetical FT protein ypo2948 SWALL:Q8ZCN3 (EMBL:AJ414154) (341 aa) FT fasta scores: E(): 1.2e-57, 47.02% id in 319 aa. Note: FT This CDS is longer in its N-terminal region than most of FT its database matches and it is also similar to BPSS0111 FT (350 aa) fasta scores: E(): 4.6e-66, 55.224% identity in FT 335 aa overlap" FT /locus_tag="BPSS0179" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS 240310..241455 FT /note="Similar to Salmonella typhimurium, and Salmonella FT enterica subsp. enterica serovar Typhimurium putative FT cytoplasmic protein stm0266 or SciA SWALL:Q93IT5 FT (EMBL:AE008707) (351 aa) fasta scores: E(): 1.7e-34, FT 45.33% id in 364 aa, and to Yersinia pestis hypothetical FT protein ypo2949 SWALL:Q8ZCN2 (EMBL:AJ414154) (393 aa) FT fasta scores: E(): 5.7e-20, 30.53% id in 393 aa. Note: FT Also similar to BPSS0110 (357 aa) fasta scores: E(): FT 1.3e-23, 44.101% identity in 356 aa overlap" FT /locus_tag="BPSS0180" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS 241527..243854 FT /note="Similar to Yersinia pestis hypothetical protein FT ypo2725 SWALL:Q8ZD67 (EMBL:AJ414153) (921 aa) fasta FT scores: E(): 4.7e-87, 45.51% id in 580 aa, and to Shigella FT flexneri Rhs-family protein sf0265 SWALL:AAN41925 FT (EMBL:AE015061) (737 aa) fasta scores: E(): 2.4e-74, FT 46.15% id in 546 aa" FT /locus_tag="BPSS0181" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS 243886..246363 FT /note="Similar in its full length to Yersinia pestis FT hypothetical y3665 SWALL:AAM87213 (EMBL:AE013969) (739 aa) FT fasta scores: E(): 6.7e-20, 24.39% id in 779 aa, FT C-terminal region to Yersinia pestis hypothetical protein FT ypo0509 SWALL:Q8ZII9 (EMBL:AJ414143) (540 aa) fasta FT scores: E(): 3.1e-09, 23.14% id in 566 aa, and N-terminal FT region to Rhizobium loti hypothetical protein mlr2351 FT SWALL:Q98IL3 (EMBL:AP002999) (367 aa) fasta scores: E(): FT 0.00016, 29.11% id in 261 aa" FT /locus_tag="BPSS0182" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT misc_feature 245419..245538 FT /note="Pfam match to entry PF00805 Pentapeptide, FT Pentapeptide repeats (8 copies) , score 50.2, E-value FT 2.9e-12" FT /colour=9 FT misc_feature 245539..245658 FT /note="Pfam match to entry PF00805 Pentapeptide, FT Pentapeptide repeats (8 copies) , score 39.8, E-value FT 4.1e-09" FT /colour=9 FT misc_feature 245734..245853 FT /note="Pfam match to entry PF00805 Pentapeptide, FT Pentapeptide repeats (8 copies) , score 12.1, E-value FT 0.023" FT /colour=9 FT misc_feature 246010..246129 FT /note="Pfam match to entry PF00805 Pentapeptide, FT Pentapeptide repeats (8 copies) , score 37.0, E-value FT 2.8e-08" FT /colour=9 FT misc_feature 246160..246279 FT /note="Pfam match to entry PF00805 Pentapeptide, FT Pentapeptide repeats (8 copies) , score 46.2, E-value FT 4.9e-11" FT /colour=9 FT CDS 246360..247442 FT /note="Similar to the C-terminal region of Anabaena sp. FT hypothetical protein all3114 SWALL:Q8YSH1 (EMBL:AP003591) FT (576 aa) fasta scores: E(): 3.3e-14, 26.19% id in 313 aa, FT and to the full length of Synechocystis sp. hypothetical FT protein sll1446 SWALL:P74206 (EMBL:D90913) (320 aa) fasta FT scores: E(): 6.2e-10, 24.76% id in 323 aa" FT /locus_tag="BPSS0183" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT misc_feature 246525..246644 FT /note="Pfam match to entry PF00805 Pentapeptide, FT Pentapeptide repeats (8 copies) , score 17.4, E-value FT 0.0065" FT /colour=9 FT misc_feature 246660..246779 FT /note="Pfam match to entry PF00805 Pentapeptide, FT Pentapeptide repeats (8 copies) , score 4.9, E-value 0.14" FT /colour=9 FT misc_feature 246780..246899 FT /note="Pfam match to entry PF00805 Pentapeptide, FT Pentapeptide repeats (8 copies) , score 15.4, E-value FT 0.01" FT /colour=9 FT misc_feature 246900..247019 FT /note="Pfam match to entry PF00805 Pentapeptide, FT Pentapeptide repeats (8 copies) , score 31.3, E-value FT 1.5e-06" FT /colour=9 FT misc_feature 247020..247139 FT /note="Pfam match to entry PF00805 Pentapeptide, FT Pentapeptide repeats (8 copies) , score 22.8, E-value FT 0.00053" FT /colour=9 FT misc_feature 247170..247289 FT /note="Pfam match to entry PF00805 Pentapeptide, FT Pentapeptide repeats (8 copies) , score 42.4, E-value FT 6.9e-10" FT /colour=9 FT CDS 247624..248283 FT /locus_tag="BPSS0184" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS 248330..248704 FT /note="Similar to Yersinia pestis hypothetical protein FT ypo0511a or y3662 SWALL:Q8ZII6 (EMBL:AJ414143) (121 aa) FT fasta scores: E(): 2e-08, 40.17% id in 117 aa" FT /locus_tag="BPSS0185" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS complement(249406..251322) FT /note="Similar to Anabaena sp. hypothetical protein FT all2038 SWALL:Q8YVE0 (EMBL:AP003588) (743 aa) fasta FT scores: E(): 2.9e-14, 28.5% id in 684 aa, and in its FT C-terminal region to Anabaena sp. hypothetical protein FT all3696 SWALL:Q8YQW5 (EMBL:AP003594) (379 aa) fasta FT scores: E(): 3.3e-05, 28.8% id in 368 aa" FT /locus_tag="BPSS0186" FT /class="4.1.0" FT /colour=3 FT /product="putative exported protein" FT misc_feature complement(251251..251322) FT /note="Signal peptide predicted for BPSS0186 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.995 between residues 24 and 25" FT /colour=3 FT CDS complement(251662..252555) FT /note="Similar to Pseudomonas aeruginosa probable FT transcriptional regulator pa1223 SWALL:Q9I4B5 FT (EMBL:AE004552) (297 aa) fasta scores: E(): 1.2e-82, FT 71.38% id in 297 aa, and to Rhizobium sp. SyrM protein FT homolog 1 SyrS1 or Y4pN SWALL:SYR1_RHISN (SWALL:P55619) FT (338 aa) fasta scores: E(): 3e-30, 39.46% id in 299 aa" FT /locus_tag="BPSS0187" FT /class="6.3.6" FT /colour=9 FT /product="putative LysR-family transcriptional regulator" FT misc_feature complement(251671..252279) FT /note="Pfam match to entry PF03466 LysR_substrate, LysR FT substrate binding domain , score 132.2, E-value 6.1e-37" FT /colour=9 FT misc_feature complement(252352..252531) FT /note="Pfam match to entry PF00126 HTH_1, Bacterial FT regulatory helix-turn-helix protein, lysR family , score FT 70.5, E-value 2.3e-18" FT /colour=9 FT misc_feature complement(252397..252489) FT /colour=8 FT /note="PS00044 Bacterial regulatory proteins, lysR family FT signature." FT misc_feature complement(252427..252492) FT /note="Predicted helix-turn-helix motif with score FT 1554.000, SD 4.48 at aa 22-43, sequence FT HNVTRAAARLNLSQPSVSIHLA" FT /colour=2 FT CDS 252651..253427 FT /note="Similar to Pseudomonas aeruginosa probable NAD(P)H FT deydrogenase pa1224 SWALL:Q9I4B4 (EMBL:AE004552) (259 aa) FT fasta scores: E(): 3.3e-82, 72.48% id in 258 aa, and to FT Rhizobium meliloti putative NADPH dehydrogenase quinone FT reductase transmembrane protein r02916 or smc03185 FT SWALL:Q92LV5 (EMBL:AL591792) (270 aa) fasta scores: E(): FT 4.7e-65, 58.52% id in 258 aa" FT /locus_tag="BPSS0188" FT /class="7.0.0" FT /colour=13 FT /product="putative dehydrogenase" FT misc_feature 252651..253313 FT /note="Pfam match to entry PF02525 Flavodoxin_2, FT Flavodoxin-like fold , score 308.2, E-value 6.5e-90" FT /colour=9 FT CDS 253453..253893 FT /note="Gene remnant. Similar to the C-terminal region of FT Streptomyces coelicolor putative AraC-family FT transcriptional regulator sco0605 or scf55.29 SWALL:Q9RJN9 FT (EMBL:AL939106) (311 aa) fasta scores: E(): 3e-22, 54.86% FT id in 144 aa, and of Mycobacterium smegmatis putative FT transcription activator SWALL:Q938B5 (EMBL:AY054120) (332 FT aa) fasta scores: E(): 1.2e-19, 47.26% id in 146 aa. CDS FT lacks an appropriate translational start codon" FT /locus_tag="BPSS0189" FT /class="6.3.2" FT /colour=11 FT /product="putative AraC-family transcriptional regulator FT (fragment)" FT /pseudo FT misc_feature 253582..253719 FT /note="Pfam match to entry PF00165 HTH_AraC, Bacterial FT regulatory helix-turn-helix proteins, araC family , score FT 34.2, E-value 1.9e-07" FT /colour=9 FT misc_feature 253618..253683 FT /note="Predicted helix-turn-helix motif with score FT 1127.000, SD 3.03 at aa 40-61, sequence FT STRDAIARQSAMSVRTLARRFQ" FT /colour=2 FT misc_feature 253738..253869 FT /note="Pfam match to entry PF00165 HTH_AraC, Bacterial FT regulatory helix-turn-helix proteins, araC family , score FT 16.0, E-value 0.049" FT /colour=9 FT CDS complement(254427..255722) FT /note="Similar to Bacillus halodurans O-acetylhomoserine FT sulfhydrylase bh2603 SWALL:Q9K9P2 (EMBL:AP001516) (430 aa) FT fasta scores: E(): 7.2e-95, 60.71% id in 420 aa, and to FT the full length of the eukaryotic Emericella nidulans FT O-acetylhomoserine CysD SWALL:CYSD_EMENI (SWALL:P50125) FT (437 aa) fasta scores: E(): 1.6e-83, 51.16% id in 430 aa" FT /locus_tag="BPSS0190" FT /class="3.1.6" FT /colour=7 FT /product="putative O-acetylhomoserine" FT misc_feature complement(254436..255689) FT /note="Pfam match to entry PF01053 Cys_Met_Meta_PP, FT Cys/Met metabolism PLP-dependent enzyme , score 686.0, FT E-value 1.2e-203" FT /colour=9 FT CDS complement(256006..256398) FT /note="Similar to Ralstonia solanacearum hypothetical FT protein rsc2017 or rs03585 SWALL:Q8XXU6 (EMBL:AL646067) FT (134 aa) fasta scores: E(): 3.9e-05, 33.61% id in 119 aa, FT and to Caulobacter crescentus hypothetical protein cc2962 FT SWALL:Q9A481 (EMBL:AE005960) (121 aa) fasta scores: E(): FT 4.2e-05, 30.64% id in 124 aa" FT /locus_tag="BPSS0191" FT /class="7.0.0" FT /colour=13 FT /product="putative dioxygenase" FT misc_feature complement(256033..256335) FT /note="Pfam match to entry PF00903 Glyoxalase, FT Glyoxalase/Bleomycin resistance protein/Dioxygenase FT superfamily , score 28.0, E-value 7e-08" FT /colour=9 FT CDS complement(256752..257597) FT /locus_tag="BPSS0192" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS complement(258412..259767) FT /locus_tag="BPSS0193" FT /class="4.1.1" FT /colour=3 FT /note="No significant database matches" FT /product="putative membrane protein" FT misc_feature complement(order(258451..258519,258529..258597,258646..258714,258730..258789,258883..258951,258979..259047,259108..259161,259204..259272,259291..259359,259417..259485,259519..259587,259615..259683)) FT /colour=0 FT /note="12 probable transmembrane helices predicted for FT BPSS0193 by TMHMM2.0 at aa 29-51, 61-83, 95-117, 137-159, FT 166-188, 203-220, 241-263, 273-295, 327-346, 352-374, FT 391-413 and 417-439" FT CDS complement(259954..260958) FT /note="Similar to Pseudomonas aeruginosa hypothetical FT protein pa0496 SWALL:Q9I622 (EMBL:AE004486) (325 aa) fasta FT scores: E(): 4.1e-81, 65.2% id in 319 aa, and similar to FT parts of Pseudomonas fluorescens urea amidolyase homologue FT UahA SWALL:Q9XAV3 (EMBL:AJ243652) (1213 aa) fasta scores: FT E(): 2.4e-34, 42.76% id in 311 aa" FT /locus_tag="BPSS0194" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT misc_feature complement(259996..260871) FT /note="Pfam match to entry PF02626 DUF183, Uncharacterized FT ACR, COG1984 , score 287.8, E-value 8.9e-84" FT /colour=9 FT CDS complement(260948..261823) FT /note="Similar to Pseudomonas aeruginosa hypothetical FT protein pa0495 SWALL:Q9I623 (EMBL:AE004486) (292 aa) fasta FT scores: E(): 5.2e-84, 69.55% id in 289 aa, and to parts of FT Pseudomonas fluorescens urea amidolyase homologue UahA FT SWALL:Q9XAV3 (EMBL:AJ243652) (1213 aa) fasta scores: E(): FT 4.9e-13, 26.18% id in 275 aa" FT /locus_tag="BPSS0195" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT misc_feature complement(261161..261817) FT /note="Pfam match to entry PF02682 DUF213, Uncharacterized FT ACR, COG2049 , score -1.6, E-value 3.6e-09" FT /colour=9 FT CDS complement(261820..263265) FT /note="Similar to Pseudomonas aeruginosa biotin FT carboxylase AccC or FabG or pa4848 SWALL:ACCC_PSEAE FT (SWALL:P37798) (449 aa) fasta scores: E(): 1.2e-81, 54.31% FT id in 440 aa, and to Bacillus halodurans acetyl-coa FT carboxylase biotin carboxylase subunit bh2787 SWALL:Q9K963 FT (EMBL:AP001516) (452 aa) fasta scores: E(): 3.6e-84, 52.7% FT id in 444 aa" FT /product="biotin carboxylase" FT /EC_number="6.3.4.14" FT /gene="accC" FT /gene="fabG" FT /locus_tag="BPSS0196" FT /class="3.6.1" FT /colour=7 FT misc_feature complement(261895..262215) FT /note="Pfam match to entry PF02785 Biotin_carb_C, Biotin FT carboxylase C-terminal domain , score 204.5, E-value FT 1e-58" FT /colour=9 FT misc_feature complement(262234..262878) FT /note="Pfam match to entry PF02786 CPSase_L_D2, FT Carbamoyl-phosphate synthase L chain, ATP binding domain , FT score 346.4, E-value 2.1e-101" FT /colour=9 FT misc_feature complement(262342..262365) FT /colour=8 FT /note="PS00867 Carbamoyl-phosphate synthase subdomain FT signature 2." FT misc_feature complement(262720..262764) FT /colour=8 FT /note="PS00866 Carbamoyl-phosphate synthase subdomain FT signature 1." FT misc_feature complement(262882..263220) FT /note="Pfam match to entry PF00289 CPSase_L_chain, FT Carbamoyl-phosphate synthase L chain, N-terminal domain , FT score 153.0, E-value 3.4e-43" FT /colour=9 FT CDS complement(263271..263537) FT /note="Similar to the full length of Pseudomonas FT aeruginosa probable biotin-requiring enzyme pa0493 FT SWALL:Q9I625 (EMBL:AE004486) (82 aa) fasta scores: E(): FT 1e-12, 52% id in 75 aa, and to the C-terminal region FT (where the biotin-binding domain lies) of Anabaena sp. FT biotin carboxyl carrier protein of acetyl-CoA carboxylase FT AccB or all5057 SWALL:BCCP_ANASP (SWALL:Q06881) (181 aa) FT fasta scores: E(): 2.9e-09, 50.68% id in 73 aa" FT /locus_tag="BPSS0197" FT /class="3.2.16" FT /colour=7 FT /product="putative biotin-binding protein" FT misc_feature complement(263280..263504) FT /note="Pfam match to entry PF00364 biotin_lipoyl, FT Biotin-requiring enzyme , score 72.6, E-value 5.5e-19" FT /colour=9 FT CDS complement(263527..264327) FT /note="Similar to Pseudomonas aeruginosa hypothetical FT protein pa0492 SWALL:Q9I626 (EMBL:AE004486) (252 aa) fasta FT scores: E(): 7.9e-69, 72.58% id in 248 aa, and to FT Escherichia coli protein YbgL or b0713 SWALL:YBGL_ECOLI FT (SWALL:P75746) (244 aa) fasta scores: E(): 8.5e-28, 38.55% FT id in 249 aa" FT /locus_tag="BPSS0198" FT /class="7.0.0" FT /colour=13 FT /product="LamB/YcsF family protein" FT misc_feature complement(263590..264315) FT /note="Pfam match to entry PF03746 LamB_YcsF, LamB/YcsF FT family , score 437.8, E-value 6.2e-129" FT /colour=9 FT CDS 264595..265509 FT /note="Similar to Escherichia coli, Escherichia coli O6, FT and Escherichia coli O157:H7 hydrogen peroxide-inducible FT genes activator OxyR or MomR or Mor or b3961 or c4922 or FT z5519 or ecs4890 SWALL:OXYR_ECOLI (SWALL:P11721) (305 aa) FT fasta scores: E(): 1.2e-18, 30.5% id in 295 aa, and to FT Pseudomonas aeruginosa probable transcriptional regulator FT pa0491 SWALL:Q9I627 (EMBL:AE004486) (308 aa) fasta scores: FT E(): 1.8e-73, 64.21% id in 299 aa" FT /locus_tag="BPSS0199" FT /class="6.3.6" FT /colour=9 FT /product="putative LysR-family transcriptional regulator" FT misc_feature 264607..264786 FT /note="Pfam match to entry PF00126 HTH_1, Bacterial FT regulatory helix-turn-helix protein, lysR family , score FT 87.4, E-value 1.9e-23" FT /colour=9 FT misc_feature 264646..264711 FT /note="Predicted helix-turn-helix motif with score FT 1374.000, SD 3.87 at aa 18-39, sequence FT GQISQAAIQLTISQSAVTSAIR" FT /colour=2 FT misc_feature 264649..264741 FT /colour=8 FT /note="PS00044 Bacterial regulatory proteins, lysR family FT signature." FT misc_feature 264853..265482 FT /note="Pfam match to entry PF03466 LysR_substrate, LysR FT substrate binding domain , score 161.7, E-value 8.2e-46" FT /colour=9 FT CDS 266228..268741 FT /note="Similar to Brucella abortus putative penicillin FT acylase II batn1953.orf25 SWALL:Q8VQK2 (EMBL:AF454951) FT (761 aa) fasta scores: E(): 6e-37, 29.86% id in 817 aa, FT and to Arthrobacter viscosus penicillin G acylase FT precursor Pac or Pa SWALL:PAC_ARTVI (SWALL:P31956) (802 FT aa) fasta scores: E(): 1.3e-33, 27.75% id in 544 aa" FT /locus_tag="BPSS0200" FT /class="7.0.0" FT /colour=13 FT /product="putative penicillin amidase" FT misc_feature 266228..266311 FT /note="Signal peptide predicted for BPSS0200 by SignalP FT 2.0 HMM (Signal peptide probability 0.980) with cleavage FT site probability 0.707 between residues 33 and 34" FT /colour=3 FT misc_feature 266267..266299 FT /colour=8 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site." FT misc_feature 266393..268708 FT /note="Pfam match to entry PF01804 Penicil_amidase, FT Penicillin amidase , score 495.7, E-value 2.4e-146" FT /colour=9 FT CDS 269128..270066 FT /note="Similar to Serratia marcescens proline FT iminopeptidase Pip SWALL:PIP_SERMA (SWALL:O32449) (317 aa) FT fasta scores: E(): 4.7e-86, 66.77% id in 310 aa, and to FT Ralstonia solanacearum probable prolyl aminopeptidase FT protein rsp0196 or rs04709 SWALL:Q8XTB7 (EMBL:AL646077) FT (320 aa) fasta scores: E(): 4.9e-88, 68.6% id in 309 aa" FT /product="prolyl iminopeptidase" FT /EC_number="3.4.11.5" FT /gene="pip" FT /locus_tag="BPSS0201" FT /class="2.2.9" FT /colour=2 FT misc_feature 269299..270051 FT /note="Pfam match to entry PF00561 abhydrolase, alpha/beta FT hydrolase fold , score 89.9, E-value 3.2e-24" FT /colour=9 FT CDS 270241..271134 FT /note="Very low similarities to parts of Mycobacterium FT tuberculosis hypothetical 37.9 kDa protein rv1523 or FT mt1574 or mtcy19g5.05C SWALL:Q50584 (EMBL:Z77826) (347 aa) FT fasta scores: E(): 9.2e-06, 35.03% id in 137 aa, and to FT Pseudomonas aeruginosa hypothetical protein pa2650 FT SWALL:Q9I0I8 (EMBL:AE004694) (269 aa) fasta scores: E(): FT 5.8e-05, 34.07% id in 135 aa" FT /locus_tag="BPSS0202" FT /class="0.0.0" FT /colour=8 FT /product="hypothetical protein" FT CDS complement(271227..273239) FT /locus_tag="BPSS0203" FT /class="4.1.0" FT /colour=3 FT /note="No significant database matches" FT /product="putative lipoprotein" FT misc_feature complement(273120..273239) FT /note="Signal peptide predicted for BPSS0203 by SignalP FT 2.0 HMM (Signal peptide probability 0.993) with cleavage FT site probability 0.407 between residues 40 and 41" FT /colour=3 FT misc_feature complement(273177..273209) FT /colour=8 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site." FT CDS complement(274149..275777) FT /note="Similar to Escherichia coli methyl-accepting FT chemotaxis protein I Tsr or CheD or b4355 SWALL:MCP1_ECOLI FT (SWALL:P02942) (551 aa) fasta scores: E(): 7.7e-55, 47.52% FT id in 484 aa, and to Ralstonia solanacearum probable FT methyl-accepting chemotaxis transmembrane protein rsc1234 FT or rs02741 SWALL:Q8Y011 (EMBL:AL646063) (514 aa) fasta FT scores: E(): 1.4e-100, 65.1% id in 513 aa" FT /product="methyl-accepting chemotaxis protein I" FT /gene="tsr" FT /gene="cheD" FT /locus_tag="BPSS0204" FT /class="1.1.1" FT /colour=0 FT misc_feature complement(274254..274952) FT /note="Pfam match to entry PF00015 MCPsignal, FT Methyl-accepting chemotaxis protein (MCP) signaling domain FT , score 350.5, E-value 1.2e-102" FT /colour=9 FT misc_feature complement(275013..275222) FT /note="Pfam match to entry PF00672 HAMP, HAMP domain , FT score 57.7, E-value 1.7e-14" FT /colour=9 FT misc_feature complement(275691..275759) FT /colour=0 FT /note="1 probable transmembrane helix predicted for FT BPSS0204 by TMHMM2.0 at aa 28-50" FT CDS complement(276127..278211) FT /note="Similar to Burkholderia sacchari PrpR SWALL:Q8VPT1 FT (EMBL:AY033092) (646 aa) fasta scores: E(): 3.9e-121, FT 60.78% id in 663 aa, and to Escherichia coli propionate FT catabolism operon regulatory protein PrpR or b0330 FT SWALL:PRPR_ECOLI (SWALL:P77743) (528 aa) fasta scores: FT E(): 3e-41, 36.99% id in 673 aa. CDS is extended at the FT C-terminus in comparison to orthologues" FT /gene="prpR" FT /locus_tag="BPSS0205" FT /class="6.5.0" FT /colour=9 FT /product="putative sigma interaction-related Fis-family FT transcriptional regulator" FT misc_feature complement(276199..276321) FT /note="Pfam match to entry PF02954 HTH_8, Bacterial FT regulatory protein, Fis family , score 42.3, E-value FT 7e-10" FT /colour=9 FT misc_feature complement(276205..276270) FT /note="Predicted helix-turn-helix motif with score FT 1005.000, SD 2.61 at aa 648-669, sequence FT GDRDRACARLGISKTTLWRKLA" FT /colour=2 FT misc_feature complement(276544..276573) FT /colour=8 FT /note="PS00688 Sigma-54 interaction domain C-terminal part FT signature." FT misc_feature complement(276547..277242) FT /note="Pfam match to entry PF00158 Sigma54_activat, FT Sigma-54 interaction domain , score 427.0, E-value FT 1.1e-125" FT /colour=9 FT misc_feature complement(277129..277170) FT /colour=8 FT /note="PS00675 Sigma-54 interaction domain ATP-binding FT region A signature." FT misc_feature complement(277453..277608) FT /note="Pfam match to entry PF00989 PAS, PAS domain , score FT 26.8, E-value 5.5e-07" FT /colour=9 FT CDS 278428..279321 FT /note="Similar to Escherichia coli probable FT methylisocitrate lyase PrpB or b0331 SWALL:PRPB_ECOLI FT (SWALL:P77541) (295 aa) fasta scores: E(): 2.4e-65, 63.01% FT id in 292 aa, and to Burkholderia sacchari PrpB FT SWALL:Q8VPT0 (EMBL:AY033092) (296 aa) fasta scores: E(): FT 6.6e-91, 85.27% id in 292 aa" FT /product="probable methylisocitrate lyase" FT /EC_number="4.1.3.30" FT /gene="prpB" FT /locus_tag="BPSS0206" FT /class="3.4.3" FT /colour=6 FT misc_feature 278674..278925 FT /note="Pfam match to entry PF00463 ICL, Isocitrate lyase FT family , score 26.5, E-value 6.2e-12" FT /colour=9 FT CDS 279370..280542 FT /note="Similar to Escherichia coli 2-methylcitrate FT synthase PrpC or b0333 SWALL:PRPC_ECOLI (SWALL:P31660) FT (389 aa) fasta scores: E(): 3.5e-119, 78.61% id in 374 aa, FT and to Burkholderia sacchari 2-methylcitrate synthase PrpC FT SWALL:Q8VPS9 (EMBL:AY033092) (388 aa) fasta scores: E(): FT 1.2e-133, 86.15% id in 390 aa" FT /product="2-methylcitrate synthase" FT /EC_number="2.3.3.5" FT /gene="prpC" FT /locus_tag="BPSS0207" FT /class="3.4.3" FT /colour=6 FT misc_feature 279439..280485 FT /note="Pfam match to entry PF00285 citrate_synt, Citrate FT synthase , score 331.7, E-value 5.6e-97" FT /colour=9 FT misc_feature 279466..279489 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT misc_feature 280186..280224 FT /colour=8 FT /note="PS00480 Citrate synthase signature." FT CDS 280616..283210 FT /note="Similar to Escherichia coli aconitate hydratase 1 FT AcnA or Acn or b1276 SWALL:ACO1_ECOLI (SWALL:P25516) (890 FT aa) fasta scores: E(): 1.7e-82, 45.46% id in 893 aa, and FT to Ralstonia solanacearum probable aconitate hydratase 1 FT transmembrane protein rsp0120 or rs03002 SWALL:Q8XTI8 FT (EMBL:AL646076) (865 aa) fasta scores: E(): 0, 86.69% id FT in 864 aa" FT /product="aconitate hydratase 1" FT /EC_number="4.2.1.3" FT /gene="acnA" FT /gene="acn" FT /locus_tag="BPSS0208" FT /class="3.5.8" FT /colour=1 FT misc_feature 280733..282214 FT /note="Pfam match to entry PF00330 aconitase, Aconitase FT family (aconitate hydratase) , score 543.3, E-value FT 1.1e-160" FT /colour=9 FT misc_feature 282578..283102 FT /note="Pfam match to entry PF00694 Aconitase_C, Aconitase FT C-terminal domain , score 114.6, E-value 1.2e-31" FT /colour=9 FT CDS 283368..284558 FT /note="Similar to Ralstonia solanacearum hypothetical FT transmembrane protein rsp0119 or rs03003 SWALL:Q8XTI9 FT (EMBL:AL646076) (396 aa) fasta scores: E(): 2.8e-129, FT 88.07% id in 394 aa, and to Burkholderia sacchari FT hypothetical 41.4 kDa protein SWALL:Q8VPS6 (EMBL:AY033092) FT (396 aa) fasta scores: E(): 4.9e-128, 86.36% id in 396 aa" FT /locus_tag="BPSS0209" FT /class="4.1.1" FT /colour=3 FT /product="putative membrane protein" FT misc_feature 284319..284387 FT /colour=0 FT /note="1 probable transmembrane helix predicted for FT BPSS0209 by TMHMM2.0 at aa 318-340" FT CDS complement(284611..285054) FT /note="Similar to Deinococcus radiodurans hypothetical FT protein dra0198 SWALL:Q9RYV8 (EMBL:AE001862) (164 aa) FT fasta scores: E(): 7.4e-21, 45.73% id in 129 aa, and to FT Rhizobium loti hypothetical protein mlr6946 SWALL:Q987R7 FT (EMBL:AP003010) (171 aa) fasta scores: E(): 1.4e-06, FT 32.39% id in 142 aa" FT /locus_tag="BPSS0210" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT misc_feature complement(284653..285024) FT /note="Pfam match to entry PF02584 DUF157, Uncharacterized FT protein PaaI, COG2050 , score 76.1, E-value 4.7e-20" FT /colour=9 FT CDS 286130..286321 FT /note="Similar to Ralstonia solanacearum hypothetical FT protein rsc1725 or rs02913 SWALL:Q8XYN3 (EMBL:AL646066) FT (63 aa) fasta scores: E(): 2.2e-08, 62.26% id in 53 aa, FT and to the C-terminal region of Ralstonia solanacearum FT hypothetical protein rsc1727 or rs02915 SWALL:Q8XYN1 FT (EMBL:AL646066) (193 aa) fasta scores: E(): 0.00076, 45.9% FT id in 61 aa" FT /locus_tag="BPSS0211" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS 286414..287052 FT /note="Similar to Ralstonia solanacearum hypothetical FT protein rsc1726 or rs02914 SWALL:Q8XYN2 (EMBL:AL646066) FT (208 aa) fasta scores: E(): 6.3e-40, 54.71% id in 212 aa, FT and to Ralstonia solanacearum hypothetical protein rsc1727 FT or rs02915 SWALL:Q8XYN1 (EMBL:AL646066) (193 aa) fasta FT scores: E(): 3.2e-13, 39.61% id in 207 aa" FT /locus_tag="BPSS0212" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS 287105..287695 FT /note="Similar to Ralstonia solanacearum hypothetical FT protein rsc1727 or rs02915 SWALL:Q8XYN1 (EMBL:AL646066) FT (193 aa) fasta scores: E(): 2.1e-33, 51.79% id in 195 aa, FT and to Ralstonia solanacearum hypothetical protein rsc1726 FT or rs02914 SWALL:Q8XYN2 (EMBL:AL646066) (208 aa) fasta FT scores: E(): 1.3e-12, 36.94% id in 203 aa" FT /locus_tag="BPSS0213" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS 287774..289249 FT /note="Similar to Ralstonia solanacearum hypothetical FT protein rsc1728 or rs02916 SWALL:Q8XYN0 (EMBL:AL646066) FT (491 aa) fasta scores: E(): 3.8e-168, 84.45% id in 489 aa, FT and to Pyrobaculum aerophilum metallo cofactor FT biosynthesis protein pae0579 SWALL:Q8ZYW8 (EMBL:AE009774) FT (384 aa) fasta scores: E(): 1.7e-19, 28.45% id in 369 aa" FT /locus_tag="BPSS0214" FT /class="3.2.6" FT /colour=7 FT /product="putative heme/metallo cofactor biosynthesis FT related protein" FT misc_feature 287957..288631 FT /note="Pfam match to entry PF01444 MoaA_NifB_PqqE, moaA / FT nifB / pqqE family , score 68.6, E-value 8.3e-18" FT /colour=9 FT CDS 289471..291084 FT /note="Similar to Salmonella typhimurium methyl-accepting FT chemotaxis protein II Tar or CheM or stm1919 FT SWALL:MCP2_SALTY (SWALL:P02941) (553 aa) fasta scores: FT E(): 9.9e-67, 47.81% id in 525 aa, and to Escherichia coli FT methyl-accepting chemotaxis protein I Tsr or CheD or b4355 FT SWALL:MCP1_ECOLI (SWALL:P02942) (551 aa) fasta scores: FT E(): 4e-63, 44.93% id in 523 aa" FT /product="methyl-accepting chemotaxis protein" FT /gene="tar" FT /gene="cheM" FT /locus_tag="BPSS0215" FT /class="1.1.1" FT /colour=0 FT misc_feature 289471..289542 FT /note="Signal peptide predicted for BPSS0215 by SignalP FT 2.0 HMM (Signal peptide probability 0.999) with cleavage FT site probability 0.770 between residues 24 and 25" FT /colour=3 FT misc_feature order(289498..289566,290026..290094) FT /colour=0 FT /note="2 probable transmembrane helices predicted for FT BPSS0215 by TMHMM2.0 at aa 10-32 and 186-208" FT misc_feature 289603..290001 FT /note="Pfam match to entry PF02203 TarH, Tar ligand FT binding domain homologue , score 45.1, E-value 1e-10" FT /colour=9 FT misc_feature 289963..289986 FT /colour=8 FT /note="PS00097 Aspartate and ornithine FT carbamoyltransferases signature." FT misc_feature 290041..290250 FT /note="Pfam match to entry PF00672 HAMP, HAMP domain , FT score 37.9, E-value 1.5e-08" FT /colour=9 FT misc_feature 290311..291009 FT /note="Pfam match to entry PF00015 MCPsignal, FT Methyl-accepting chemotaxis protein (MCP) signaling domain FT , score 343.0, E-value 2.2e-100" FT /colour=9 FT CDS complement(291447..293084) FT /note="Similar to Rhizobium loti transmembrane efflux FT protein mll5686 SWALL:Q98B85 (EMBL:AP003007) (502 aa) FT fasta scores: E(): 3.1e-40, 32.99% id in 491 aa, and to FT Streptomyces glaucescens tetracenomycin C resistance and FT export protein TcmA SWALL:TCMA_STRGA (SWALL:P39886) (538 FT aa) fasta scores: E(): 1.7e-37, 31.08% id in 518 aa. Note: FT This CDS is longer in its N-terminal region than most of FT its database matches" FT /locus_tag="BPSS0216" FT /class="4.1.1" FT /colour=3 FT /product="putative membrane protein" FT misc_feature complement(order(291474..291542,291702..291770,291849..291908,291921..291980,291999..292067,292110..292178,292239..292307,292320..292376,292413..292481,292494..292562,292596..292664,292677..292745,292764..292832)) FT /colour=0 FT /note="13 probable transmembrane helices predicted for FT BPSS0216 by TMHMM2.0 at aa 85-107, 114-136, 141-163, FT 175-197, 202-224, 237-255, 260-282, 303-325, 340-362, FT 369-388, 393-412, 439-461 and 515-537" FT misc_feature complement(292728..292778) FT /colour=8 FT /note="PS00216 Sugar transport proteins signature 1." FT CDS 293213..294070 FT /note="Similar to Agrobacterium tumefaciens FT transcriptional regulator, LysR family atu4021 or FT agr_l_1663 SWALL:Q8U8R9 (EMBL:AE009333) (309 aa) fasta FT scores: E(): 2.6e-32, 37.2% id in 293 aa, and to Yersinia FT pestis probable LysR-family transcriptional regulator FT ypo1929 SWALL:Q8ZF22 (EMBL:AJ414150) (292 aa) fasta FT scores: E(): 1.6e-23, 31.59% id in 288 aa" FT /locus_tag="BPSS0217" FT /class="6.3.6" FT /colour=9 FT /product="putative LysR-family transcriptional regulator" FT misc_feature 293213..293392 FT /note="Pfam match to entry PF00126 HTH_1, Bacterial FT regulatory helix-turn-helix protein, lysR family , score FT 70.3, E-value 2.6e-18" FT /colour=9 FT misc_feature 293231..293251 FT /colour=8 FT /note="PS00290 Immunoglobulins and major FT histocompatibility complex proteins signature." FT misc_feature 293252..293317 FT /note="Predicted helix-turn-helix motif with score FT 1289.000, SD 3.58 at aa 29-50, sequence FT LHFARAADELDIAPPALTRLVQ" FT /colour=2 FT misc_feature 293462..294064 FT /note="Pfam match to entry PF03466 LysR_substrate, LysR FT substrate binding domain , score 100.2, E-value 2.7e-27" FT /colour=9 FT CDS complement(294153..295256) FT /note="Similar to Ralstonia solanacearum probable FT mannose-6-phosphate isomerase protein ManA or rsc3058 or FT rs00502 SWALL:Q8XUX5 (EMBL:AL646073) (410 aa) fasta FT scores: E(): 1.6e-39, 43.22% id in 391 aa, and to FT Rhizobium meliloti mannose-6-phosphate isomerase Pmi or FT r02982 or smc03111 SWALL:MANA_RHIME (SWALL:P29954) (387 FT aa) fasta scores: E(): 9.4e-06, 28.75% id in 386 aa" FT /locus_tag="BPSS0218" FT /class="7.0.0" FT /colour=13 FT /product="putative isomerase" FT CDS 295367..296062 FT /note="Similar to Escherichia coli, and Escherichia coli FT O157:H7 hypothetical protein YhiD or b3508 or z4920 or FT ecs4388 SWALL:YHID_ECOLI (SWALL:P26606) (215 aa) fasta FT scores: E(): 1.1e-24, 40.55% id in 217 aa, and to Aquifex FT aeolicus Mg(2+) transport ATPase MgtC or aq_447 FT SWALL:O66755 (EMBL:AE000690) (225 aa) fasta scores: E(): FT 6.8e-20, 39.3% id in 201 aa" FT /locus_tag="BPSS0219" FT /class="4.1.1" FT /colour=3 FT /product="MgtC family membrane protein" FT misc_feature order(295367..295435,295478..295546,295580..295648,295691..295759) FT /colour=0 FT /note="4 probable transmembrane helices predicted for FT BPSS0219 by TMHMM2.0 at aa 13-35, 50-72, 84-106 and FT 121-143" FT misc_feature 295397..295798 FT /note="Pfam match to entry PF02308 MgtC, MgtC family , FT score 181.9, E-value 6.7e-52" FT /colour=9 FT CDS 296382..297662 FT /locus_tag="BPSS0220" FT /class="4.1.1" FT /colour=3 FT /note="No significant database matches. Possible FT alternative translational start site" FT /product="putative membrane protein" FT misc_feature 297393..297461 FT /colour=0 FT /note="1 probable transmembrane helix predicted for FT BPSS0220 by TMHMM2.0 at aa 338-360" FT CDS complement(297814..298842) FT /note="Doubtful CDS. Poor database matches. Weakly similar FT to the N-terminal region of Mycobacterium paratuberculosis FT FtsQ ftsQ SWALL:Q73YR0 (EMBL:AE017233) (375 aa) fasta FT scores: E(): 0.00018, 31.51% id in 330 aa" FT /product="hypothetical protein" FT /colour=8 FT /locus_tag="BPSS0221A" FT /class="0.0.0" FT CDS 299030..299500 FT /note="Similar to Listeria monocytogenes hypothetical FT protein lmo0624 SWALL:Q8Y9A8 (EMBL:AL591976) (147 aa) FT fasta scores: E(): 2.4e-12, 32.43% id in 148 aa, and to FT Bacillus subtilis YycN protein SWALL:O32293 (EMBL:Z99124) FT (156 aa) fasta scores: E(): 1.9e-11, 30.71% id in 153 aa" FT /locus_tag="BPSS0222" FT /class="7.0.0" FT /colour=13 FT /product="putative acetyltransferase" FT misc_feature 299210..299458 FT /note="Pfam match to entry PF00583 Acetyltransf, FT Acetyltransferase (GNAT) family , score 64.8, E-value FT 1.2e-16" FT /colour=9 FT CDS complement(299703..300371) FT /locus_tag="BPSS0223" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS complement(300572..303502) FT /note="No significant database matches to the full length FT CDS. N-terminal region is similar to Similar to Homo FT sapiens copper-transporting ATPase 2 ATP7B or WND or PWD FT or WC1 SWALL:AT7B_HUMAN (SWALL:P35670) (1465 aa) fasta FT scores: E(): 3e-07, 27% id in 300 aa. C-terminal region is FT similar to Ralstonia solanacearum probable FT cation-transporting ATPase transmembrane protein rsc3348 FT or rs02623 SWALL:Q8XU45 (EMBL:AL646074) (748 aa) fasta FT scores: E(): 1.1e-121, 59.89% id in 768 aa, and to FT Synechocystis sp. cation-transporting ATPase PacS or FT sll1920 SWALL:ATCS_SYNY3 (SWALL:P73241) (745 aa) fasta FT scores: E(): 2.8e-81, 44.01% id in 777 aa" FT /locus_tag="BPSS0224" FT /class="1.5.2" FT /colour=3 FT /product="putative cation-transporting ATPase membrane FT protein" FT misc_feature complement(order(300599..300658,300668..300727,301622..301690,301718..301786,302195..302254,302267..302335,302369..302437,302447..302515)) FT /colour=0 FT /note="8 probable transmembrane helices predicted for FT BPSS0224 by TMHMM2.0 at aa 330-352, 356-378, 390-412, FT 417-436, 573-595, 605-627, 926-945 and 949-968" FT misc_feature complement(300836..301549) FT /note="Pfam match to entry PF00702 Hydrolase, haloacid FT dehalogenase-like hydrolase , score 110.4, E-value FT 2.2e-30" FT /colour=9 FT misc_feature complement(300839..300907) FT /colour=8 FT /note="PS01229 Hypothetical cof family signature 2." FT misc_feature complement(301511..301531) FT /colour=8 FT /note="PS00154 E1-E2 ATPases phosphorylation site." FT misc_feature complement(301559..302221) FT /note="Pfam match to entry PF00122 E1-E2_ATPase, E1-E2 FT ATPase , score 323.2, E-value 2e-94" FT /colour=9 FT misc_feature complement(302633..302833) FT /note="Pfam match to entry PF00403 HMA, FT Heavy-metal-associated domain , score 94.5, E-value FT 1.4e-25" FT /colour=9 FT misc_feature complement(302732..302821) FT /colour=8 FT /note="PS01047 Heavy-metal-associated domain." FT misc_feature complement(302975..303169) FT /note="Pfam match to entry PF00403 HMA, FT Heavy-metal-associated domain , score 74.5, E-value FT 1.5e-19" FT /colour=9 FT misc_feature complement(303068..303157) FT /colour=8 FT /note="PS01047 Heavy-metal-associated domain." FT misc_feature complement(303266..303460) FT /note="Pfam match to entry PF00403 HMA, FT Heavy-metal-associated domain , score 74.8, E-value FT 1.1e-19" FT /colour=9 FT misc_feature complement(303359..303448) FT /colour=8 FT /note="PS01047 Heavy-metal-associated domain." FT repeat_region 303972..304223 FT /note="contains perfect hexamer repeat, ggcaac x42" FT CDS 304350..305177 FT /locus_tag="BPSS0225" FT /class="4.1.0" FT /colour=3 FT /note="No significant database matches" FT /product="putative exported protein" FT misc_feature 304350..304427 FT /note="Signal peptide predicted for BPSS0225 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.628 between residues 26 and 27" FT /colour=3 FT CDS 305951..307372 FT /note="Similar to Ralstonia solanacearum hypothetical FT transmembrane protein rsc0254 or rs00689 SWALL:Q8Y2T1 FT (EMBL:AL646058) (542 aa) fasta scores: E(): 1.1e-24, FT 34.67% id in 522 aa, and to Listeria monocytogenes FT hypothetical protein lmo0525 SWALL:Q8Y9K2 (EMBL:AL591975) FT (443 aa) fasta scores: E(): 8.1e-18, 28.17% id in 465 aa" FT /locus_tag="BPSS0226" FT /class="4.1.0" FT /colour=3 FT /product="putative lipoprotein" FT misc_feature 305951..306031 FT /note="Signal peptide predicted for BPSS0226 by SignalP FT 2.0 HMM (Signal peptide probability 0.997) with cleavage FT site probability 0.231 between residues 27 and 28" FT /colour=3 FT misc_feature 306002..306034 FT /colour=8 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site." FT CDS 307527..311486 FT /note="Similar to Ralstonia solanacearum putative FT transmembrane protein rsc0896 or rs06183 SWALL:Q8Y0Z7 FT (EMBL:AL646061) (1261 aa) fasta scores: E(): 8e-67, 44.29% FT id in 1314 aa, and to Pseudomonas aeruginosa hypothetical FT protein pa4735 SWALL:Q9HV64 (EMBL:AE004887) (1088 aa) FT fasta scores: E(): 1.9e-29, 24.82% id in 1305 aa" FT /locus_tag="BPSS0227" FT /class="4.1.1" FT /colour=3 FT /product="putative membrane protein" FT misc_feature 307608..307676 FT /colour=0 FT /note="1 probable transmembrane helix predicted for FT BPSS0227 by TMHMM2.0 at aa 59-81" FT CDS complement(311611..311874) FT /locus_tag="BPSS0228" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS complement(312200..313861) FT /note="Similar to Rhizobium loti hypothetical protein FT mlr2187 SWALL:Q98IY7 (EMBL:AP002999) (508 aa) fasta FT scores: E(): 1.1e-53, 43.19% id in 551 aa" FT /locus_tag="BPSS0229" FT /class="4.1.0" FT /colour=3 FT /product="putative exported protein" FT misc_feature complement(313781..313861) FT /note="Signal peptide predicted for BPSS0229 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.900 between residues 39 and 40" FT /colour=3 FT CDS complement(314442..314834) FT /note="Similar to Photorhabdus luminescens ORF38 FT SWALL:AAO18063 (EMBL:AY144116) (131 aa) fasta scores: E(): FT 1.7e-23, 47.61% id in 126 aa, and to Bacillus subtilis FT hypothetical protein YycE SWALL:YYCE_BACSU (SWALL:P37479) FT (139 aa) fasta scores: E(): 1.1e-16, 38.52% id in 122 aa" FT /locus_tag="BPSS0230" FT /class="7.0.0" FT /colour=13 FT /product="Glyoxalase/Bleomycin resistance FT protein/Dioxygenase superfamily protein" FT misc_feature complement(314445..314801) FT /note="Pfam match to entry PF00903 Glyoxalase, FT Glyoxalase/Bleomycin resistance protein/Dioxygenase FT superfamily , score 42.0, E-value 8.8e-10" FT /colour=9 FT CDS complement(314959..315243) FT /note="Similar to the N-terminal region of Ralstonia FT solanacearum hypothetical protein RSP1103 or RS02609 FT SWALL:Q8XQW5 (EMBL:AL646082) (56 aa) fasta scores: E(): 2, FT 45.65% id in 46 aa" FT /product="hypothetical protein" FT /locus_tag="BPSS0231" FT /class="0.0.0" FT /colour=8 FT CDS 315412..316482 FT /note="Similar to Methylococcus capsulatus squalene FT synthase Sqs SWALL:O69445 (EMBL:Y09978) (362 aa) fasta FT scores: E(): 8.3e-20, 29.1% id in 323 aa" FT /locus_tag="BPSS0232" FT /class="7.0.0" FT /colour=13 FT /product="putative squalene/phytoene synthase" FT misc_feature 315472..316416 FT /note="Pfam match to entry PF00494 SQS_PSY, FT Squalene/phytoene synthase , score 27.3, E-value 4.2e-13" FT /colour=9 FT misc_feature 315853..315891 FT /colour=8 FT /note="PS00018 EF-hand calcium-binding domain." FT CDS complement(join(316508..316633,316633..316734,316734..316817,316820..317098)) FT /note="Probable gene rement. Similar to the C-terminal FT regions of Bordetella pertussis probable LysR-family FT transcriptional regulator bp1607 SWALL:Q7VXW7 FT (EMBL:BX640415) (300 aa) fasta scores: E(): 3.4e-41, FT 62.98% id in 181 aa, and Ralstonia solanacearum probable FT transcription regulator protein rsc1152 or rs04599 FT SWALL:Q8Y092 (EMBL:AL646063) (297 aa) fasta scores: E(): FT 5.8e-37, 59.66% id in 181 aa. CDS contains several FT framshift mutations" FT /class="6.3.6" FT /colour=11 FT /product="LysR-family regulatory protein (fragment)" FT /locus_tag="BPSS0233" FT /pseudo FT misc_feature complement(316844..317098) FT /note="Pfam match to entry PF03466 LysR_substrate, LysR FT substrate binding domain , score 47.4, E-value 6.8e-13" FT /colour=9 FT CDS join(317332..317361,317365..317523) FT /note="Similar to Chromobacterium violaceum hypothetical FT protein cv0784 SWALL:Q7NZY5 (EMBL:AE016912) (62 aa) fasta FT scores: E(): 1.1e-20, 82.25% id in 62 aa, and to FT Bordetella bronchiseptica putative membrane protein bb2409 FT SWALL:Q7WJT4 (EMBL:BX640444) (64 aa) fasta scores: E(): FT 1.1e-18, 74.6% id in 63 aa. CDS contains a nonsense FT mutation (opal) after codon 10" FT /product="putative membrane protein (pseudogene)" FT /locus_tag="BPSS0233a" FT /class="4.1.1" FT /colour=11 FT /pseudo FT CDS complement(318009..319016) FT /note="Similar to Pseudomonas aeruginosa cyanide FT insensitive terminal oxidase CioB or pa3929 SWALL:O07441 FT (EMBL:Y10528) (335 aa) fasta scores: E(): 3.3e-78, 60.59% FT id in 335 aa, and to Escherichia coli, Escherichia coli FT O6, and Escherichia coli O157:H7 cytochrome D ubiquinol FT oxidase subunit II CydB or Cyd-2 or b0734 or c0812 or FT z0901 or ecs0769 SWALL:CYDB_ECOLI (SWALL:P11027) (379 aa) FT fasta scores: E(): 1.3e-21, 28.22% id in 372 aa" FT /locus_tag="BPSS0234" FT /class="3.5.3" FT /colour=1 FT /product="putative cytochrome oxidase subunit II" FT misc_feature complement(318039..319016) FT /note="Pfam match to entry PF02322 Cyto_ox_2, Cytochrome FT oxidase subunit II , score 465.2, E-value 3.4e-137" FT /colour=9 FT misc_feature complement(order(318054..318122,318180..318248,318285..318344,318387..318446,318483..318551,318609..318677,318735..318803,318912..318980)) FT /colour=0 FT /note="8 probable transmembrane helices predicted for FT BPSS0234 by TMHMM2.0 at aa 13-35, 72-94, 114-136, 156-178, FT 191-210, 225-244, 257-279 and 299-321" FT CDS complement(319052..320464) FT /note="Similar to Salmonella typhimurium cytochrome BD2 FT subunit I stm0360 SWALL:Q8ZRG3 (EMBL:AE008712) (467 aa) FT fasta scores: E(): 1e-118, 65.73% id in 467 aa, and to FT Escherichia coli, and Escherichia coli O6 cytochrome D FT ubiquinol oxidase subunit I CydA or Cyd-1 or b0733 or FT c0811 SWALL:CYDA_ECOLI (SWALL:P11026) (522 aa) fasta FT scores: E(): 2.4e-39, 31.67% id in 502 aa" FT /locus_tag="BPSS0235" FT /class="3.5.3" FT /colour=1 FT /product="putative cytochrome oxidase subunit I" FT misc_feature complement(319106..320437) FT /note="Pfam match to entry PF01654 Bac_Ubq_Cox, Bacterial FT Cytochrome Ubiquinol Oxidase , score 718.0, E-value FT 2.8e-213" FT /colour=9 FT misc_feature complement(order(319175..319243,319328..319396,319430..319498,319748..319801,319838..319906,320015..320083,320102..320170,320228..320296,320354..320422)) FT /colour=0 FT /note="9 probable transmembrane helices predicted for FT BPSS0235 by TMHMM2.0 at aa 15-37, 57-79, 99-121, 128-150, FT 187-209, 222-239, 323-345, 357-379 and 408-430" FT CDS 321065..322078 FT /note="Similar to Escherichia coli low-specificity FT L-threonine aldolase LtaE or b0870 SWALL:LTAE_ECOLI FT (SWALL:P75823) (333 aa) fasta scores: E(): 1.4e-68, 58.98% FT id in 334 aa, and to Salmonella typhimurium LT2 FT L-allo-threonine aldolase LtaA SWALL:Q8ZQF1 FT (EMBL:AE008737) (333 aa) fasta scores: E(): 1.3e-70, FT 61.07% id in 334 aa" FT /product="L-allo-threonine aldolase" FT /EC_number="4.1.2.5" FT /gene="ltaE" FT /locus_tag="BPSS0236" FT /class="3.1.9" FT /colour=7 FT CDS complement(322047..323024) FT /note="Similar to Escherichia coli, Escherichia coli O6, FT and Escherichia coli O157:H7 chromosome initiation FT inhibitor IciA or b2916 or c3497 or z4253 or ecs3786 FT SWALL:ICIA_ECOLI (SWALL:P24194) (297 aa) fasta scores: FT E(): 4.6e-31, 35.83% id in 293 aa, and to Aeromonas FT salmonicida chromosome initiation inhibitor IciA FT SWALL:ICIA_AERSA (SWALL:P70773) (299 aa) fasta scores: FT E(): 6.5e-37, 38.17% id in 296 aa. CDS is extended at the FT C-terminus in comparison to orthologues" FT /locus_tag="BPSS0237" FT /class="6.3.6" FT /colour=9 FT /product="putative LysR-family transcriptional regulator" FT misc_feature complement(322836..323012) FT /note="Pfam match to entry PF00126 HTH_1, Bacterial FT regulatory helix-turn-helix protein, lysR family , score FT 69.2, E-value 5.8e-18" FT /colour=9 FT misc_feature complement(322878..322970) FT /colour=8 FT /note="PS00044 Bacterial regulatory proteins, lysR family FT signature." FT misc_feature complement(322908..322973) FT /note="Predicted helix-turn-helix motif with score FT 1497.000, SD 4.29 at aa 27-48, sequence FT GSFEQAAARLHVTASAVTQRVR" FT /colour=2 FT CDS 323180..325342 FT /note="Similar to Bacillus subtilis penicillin-binding FT protein 1A/1B PonA SWALL:PBPA_BACSU (SWALL:P39793) (914 FT aa) fasta scores: E(): 8.7e-44, 30.94% id in 685 aa, and FT to Escherichia coli penicillin-binding protein 1B MrcB or FT PonB or PbpF or b0149 SWALL:PBPB_ECOLI (SWALL:P02919) (844 FT aa) fasta scores: E(): 9.3e-43, 31.98% id in 591 aa" FT /locus_tag="BPSS0238" FT /class="4.1.2" FT /colour=3 FT /product="putative penicillin-binding protein" FT misc_feature 323291..323350 FT /colour=0 FT /note="1 probable transmembrane helix predicted for FT BPSS0238 by TMHMM2.0 at aa 38-57" FT misc_feature 323414..323920 FT /note="Pfam match to entry PF00912 Transglycosyl, FT Transglycosylase , score 300.6, E-value 1.2e-87" FT /colour=9 FT misc_feature 324149..325051 FT /note="Pfam match to entry PF00905 Transpeptidase, FT Penicillin binding protein transpeptidase domain , score FT 64.6, E-value 1.4e-16" FT /colour=9 FT CDS 325355..325963 FT /note="Similar to Escherichia coli, and Escherichia coli FT O6 hypothetical protein YicG or b3646 or c4470 FT SWALL:YICG_ECOLI (SWALL:P31432) (205 aa) fasta scores: FT E(): 5.6e-29, 42.57% id in 202 aa, and to Vibrio cholerae FT hypothetical protein Vc2115 vc2115 SWALL:Q9KQ86 FT (EMBL:AE004285) (207 aa) fasta scores: E(): 1.2e-32, FT 51.77% id in 197 aa" FT /locus_tag="BPSS0239" FT /class="4.1.1" FT /colour=3 FT /product="putative membrane protein" FT misc_feature 325355..325612 FT /note="Pfam match to entry PF03458 UPF0126, UPF0126 domain FT , score 99.2, E-value 5.2e-27" FT /colour=9 FT misc_feature order(325364..325417,325436..325495,325538..325597,325610..325678,325688..325756,325790..325849,325862..325915) FT /colour=0 FT /note="7 probable transmembrane helices predicted for FT BPSS0239 by TMHMM2.0 at aa 4-21, 28-47, 62-81, 86-108, FT 112-134, 146-165 and 170-187" FT misc_feature 325613..325882 FT /note="Pfam match to entry PF03458 UPF0126, UPF0126 domain FT , score 86.9, E-value 2.7e-23" FT /colour=9 FT CDS complement(326012..326830) FT /note="Similar to Yersinia pestis hemin transport system FT ATP-binding protein HmuV or ypo0279 or y0539 FT SWALL:HMUV_YERPE (SWALL:Q56993) (266 aa) fasta scores: FT E(): 6.3e-13, 45.05% id in 253 aa, and to Bordetella avium FT BhuV SWALL:AAM28272 (EMBL:AY095952) (261 aa) fasta scores: FT E(): 6.9e-20, 46.64% id in 253 aa" FT /locus_tag="BPSS0240" FT /class="1.6.3" FT /colour=0 FT /product="putative hemin ABC transport system, ATP-binding FT protein" FT misc_feature complement(326012..333184) FT /note="putative hmu cluster" FT /colour=0 FT misc_feature complement(326138..326752) FT /note="Pfam match to entry PF00005 ABC_tran, ABC FT transporter , score 141.9, E-value 7.2e-40" FT /colour=9 FT misc_feature complement(326351..326395) FT /colour=8 FT /note="PS00211 ABC transporters family signature." FT misc_feature complement(326708..326731) FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT CDS complement(327285..328406) FT /note="Similar to Yersinia pestis hemin transport system FT permease protein HmuU or ypo0280 or y0540 SWALL:HMUU_YERPE FT (SWALL:Q56992) (334 aa) fasta scores: E(): 2.6e-43, 45.48% FT id in 343 aa, and to Bordetella avium BhuU SWALL:Q8L1U4 FT (EMBL:AY095952) (334 aa) fasta scores: E(): 9.1e-45, FT 49.41% id in 344 aa" FT /locus_tag="BPSS0241" FT /class="1.6.3" FT /colour=0 FT /product="putative hemin ABC transport system, membrane FT protein" FT misc_feature complement(327309..328241) FT /note="Pfam match to entry PF01032 FecCD, FecCD transport FT family , score 310.3, E-value 1.5e-90" FT /colour=9 FT misc_feature complement(order(327312..327371,327408..327461,327504..327572,327666..327725,327783..327851,327885..327953,327963..328031,328050..328118,328227..328295)) FT /colour=0 FT /note="9 probable transmembrane helices predicted for FT BPSS0241 by TMHMM2.0 at aa 38-60, 97-119, 126-148, FT 152-174, 186-208, 228-247, 279-301, 316-333 and 346-365" FT CDS complement(328774..329700) FT /note="Similar to Yersinia pestis hemin-binding FT periplasmic protein precursor HmuT or ypo0281 or y0541 FT SWALL:HMUT_YERPE (SWALL:Q56991) (279 aa) fasta scores: FT E(): 2.7e-17, 41.72% id in 266 aa, and to Escherichia coli FT O157:H7 putative periplasmic binding protein ChuT or z4913 FT or ecs4382 SWALL:Q8X5N7 (EMBL:AE005576) (304 aa) fasta FT scores: E(): 8.4e-22, 32.97% id in 276 aa" FT /locus_tag="BPSS0242" FT /class="1.6.3" FT /colour=0 FT /product="putative hemin transport system, FT substrate-binding protein" FT misc_feature complement(328852..329583) FT /note="Pfam match to entry PF01497 Peripla_BP_2, FT Periplasmic binding protein , score 128.7, E-value FT 6.7e-36" FT /colour=9 FT misc_feature complement(329605..329664) FT /colour=0 FT /note="1 probable transmembrane helix predicted for FT BPSS0242 by TMHMM2.0 at aa 13-32" FT misc_feature complement(329605..329700) FT /note="Signal peptide predicted for BPSS0242 by SignalP FT 2.0 HMM (Signal peptide probability 0.996) with cleavage FT site probability 0.843 between residues 32 and 33" FT /colour=3 FT CDS complement(329697..330848) FT /note="Similar to Yersinia pestis hemin transport protein FT HmuS or ypo0282 or y0542 SWALL:HMUS_YERPE (SWALL:Q56990) FT (345 aa) fasta scores: E(): 1.8e-45, 42.2% id in 327 aa, FT and to Ralstonia solanacearum probable hemin transport FT protein rsp0243 or rs03723 SWALL:Q8XT72 (EMBL:AL646077) FT (380 aa) fasta scores: E(): 3.5e-70, 56.7% id in 358 aa" FT /locus_tag="BPSS0243" FT /class="1.6.3" FT /colour=0 FT /product="putative hemin ABC transport system-related FT protein" FT CDS complement(330905..333184) FT /note="Similar to Caulobacter crescentus TonB-dependent FT receptor cc2194 SWALL:Q9A6A0 (EMBL:AE005891) (733 aa) FT fasta scores: E(): 4.5e-100, 41.94% id in 739 aa, and to FT Vibrio mimicus heme receptor precursor MhuA SWALL:Q9AQK5 FT (EMBL:AB048382) (710 aa) fasta scores: E(): 1.9e-33, FT 29.43% id in 727 aa" FT /locus_tag="BPSS0244" FT /class="1.6.3" FT /colour=0 FT /product="putative exported heme receptor protein" FT misc_feature complement(330908..331264) FT /note="Pfam match to entry PF00593 TonB_boxC, TonB FT dependent receptor C-terminal region , score 63.9, E-value FT 2.3e-16" FT /colour=9 FT misc_feature complement(333116..333184) FT /note="Signal peptide predicted for BPSS0244 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.852 between residues 23 and 24" FT /colour=3 FT CDS complement(333659..333886) FT /locus_tag="BPSS0245" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS complement(334048..334944) FT /note="Similar to Escherichia coli, Escherichia coli O6, FT and Escherichia coli O157:H7 glycine cleavage system FT transcriptional activator GcvA or b2808 or c3378 or z4125 FT or ecs3668 SWALL:GCVA_ECOLI (SWALL:P32064) (305 aa) fasta FT scores: E(): 7.3e-26, 32.88% id in 298 aa, and to FT Pseudomonas aeruginosa probable transcriptional regulator FT pa0448 SWALL:Q9I670 (EMBL:AE004482) (302 aa) fasta scores: FT E(): 2.3e-33, 37.07% id in 294 aa" FT /locus_tag="BPSS0246" FT /class="6.3.6" FT /colour=9 FT /product="putative LysR-family transcriptional regulator" FT misc_feature complement(334057..334677) FT /note="Pfam match to entry PF03466 LysR_substrate, LysR FT substrate binding domain , score 117.2, E-value 2e-32" FT /colour=9 FT misc_feature complement(334744..334923) FT /note="Pfam match to entry PF00126 HTH_1, Bacterial FT regulatory helix-turn-helix protein, lysR family , score FT 87.5, E-value 1.7e-23" FT /colour=9 FT misc_feature complement(334789..334881) FT /colour=8 FT /note="PS00044 Bacterial regulatory proteins, lysR family FT signature." FT misc_feature complement(334819..334884) FT /note="Predicted helix-turn-helix motif with score FT 2037.000, SD 6.12 at aa 21-42, sequence FT LNFSYAARELGLTPSAVSRQIA" FT /colour=2 FT CDS 335111..335959 FT /note="Similar to Pseudomonas aeruginosa probable permease FT of ABC transporter pa3253 SWALL:Q9HYY7 (EMBL:AE004747) FT (265 aa) fasta scores: E(): 2.2e-19, 29.32% id in 266 aa, FT and to Ralstonia solanacearum probable permease FT transmembrane ABC transporter protein rsc1793 or rs04192 FT SWALL:Q8XYG5 (EMBL:AL646066) (265 aa) fasta scores: E(): FT 1e-14, 28.15% id in 238 aa" FT /locus_tag="BPSS0247" FT /class="4.1.1" FT /colour=3 FT /product="putative ABC transport system, membrane protein" FT misc_feature order(335240..335308,335366..335434,335471..335539,335552..335620,335741..335809,335852..335920) FT /colour=0 FT /note="6 probable transmembrane helices predicted for FT BPSS0247 by TMHMM2.0 at aa 3-25, 45-67, 80-102, 107-129, FT 170-192 and 207-229" FT misc_feature 335567..335599 FT /colour=8 FT /note="PS00435 Peroxidases proximal heme-ligand FT signature." FT misc_feature 335636..335860 FT /note="Pfam match to entry PF00528 BPD_transp, FT Binding-protein-dependent transport systems inner membrane FT component , score 23.1, E-value 0.00032" FT /colour=9 FT CDS 335964..337007 FT /note="Similar to Rhizobium loti ABC transporter, FT ATP-binding protein mll2948 SWALL:Q98HB1 (EMBL:AP003000) FT (371 aa) fasta scores: E(): 8.1e-41, 43.31% id in 314 aa, FT and to Alicyclobacillus acidocaldarius putative FT ABC-transporter ATP-binding protein CysA SWALL:Q9RHZ7 FT (EMBL:AJ252160) (393 aa) fasta scores: E(): 1.4e-37, 46.1% FT id in 295 aa" FT /locus_tag="BPSS0248" FT /class="4.1.1" FT /colour=3 FT /product="putative ABC transport system, ATP-binding FT protein" FT misc_feature 336048..336593 FT /note="Pfam match to entry PF00005 ABC_tran, ABC FT transporter , score 229.2, E-value 3.9e-66" FT /colour=9 FT misc_feature 336069..336092 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT misc_feature 336363..336407 FT /colour=8 FT /note="PS00211 ABC transporters family signature." FT CDS 337034..338122 FT /note="Similar to Ralstonia solanacearum probable FT solute-binding periplasmic rsc1791 or rs04190 SWALL:Q8XYG7 FT (EMBL:AL646066) (343 aa) fasta scores: E(): 1.5e-37, FT 37.27% id in 330 aa, and to Campylobacter jejuni putative FT periplasmic solute-binding protein cj0727 SWALL:Q9PPI0 FT (EMBL:AL139076) (348 aa) fasta scores: E(): 8.9e-28, FT 31.05% id in 351 aa" FT /locus_tag="BPSS0249" FT /class="4.1.0" FT /colour=3 FT /product="putative ABC transport system, substrate-binding FT exported protein" FT misc_feature 337034..337126 FT /note="Signal peptide predicted for BPSS0249 by SignalP FT 2.0 HMM (Signal peptide probability 0.999) with cleavage FT site probability 0.894 between residues 41 and 42" FT /colour=3 FT misc_feature 337196..338101 FT /note="Pfam match to entry PF01547 SBP_bac_1, Bacterial FT extracellular solute-binding protein , score 45.7, E-value FT 6.9e-11" FT /colour=9 FT CDS 338112..338960 FT /note="Similar to Ralstonia solanacearum probable FT transport system permease transmembrane ABC transporter FT protein rsc1792 or rs04191 SWALL:Q8XYG6 (EMBL:AL646066) FT (282 aa) fasta scores: E(): 4.9e-17, 35.03% id in 254 aa, FT and to Agrobacterium tumefaciens ABC transporter, membrane FT spanning protein atu2148 or agr_c_3892 SWALL:Q8UDH7 FT (EMBL:AE009165) (331 aa) fasta scores: E(): 3.4e-15, FT 31.53% id in 260 aa" FT /locus_tag="BPSS0250" FT /class="4.1.1" FT /colour=3 FT /product="putative ABC transport system, membrane protein" FT misc_feature order(338172..338240,338316..338384,338418..338486,338544..338603,338748..338816,338874..338942) FT /colour=0 FT /note="6 probable transmembrane helices predicted for FT BPSS0250 by TMHMM2.0 at aa 21-43, 69-91, 103-125, 145-164, FT 213-235 and 255-277" FT CDS 338974..339486 FT /note="C-terminal region is similar to Methanosarcina FT mazei hypothetical protein mm3075 SWALL:Q8PSK4 FT (EMBL:AE013563) (156 aa) fasta scores: E(): 3.9e-14, FT 43.38% id in 136 aa, and Aquifex pyrophilus hypothetical FT protein SWALL:AAN12294 (EMBL:AY135660) (150 aa) fasta FT scores: E(): 1.4e-12, 38.62% id in 145 aa. Possible FT alternative start codon at codon 20" FT /locus_tag="BPSS0251" FT /class="7.0.0" FT /colour=13 FT /product="Lysine decarboxylase family protein" FT misc_feature 339154..339354 FT /note="Pfam match to entry PF03641 Lysine_decarbox, Lysine FT decarboxylase family , score 19.1, E-value 7.1e-06" FT /colour=9 FT CDS 339553..340752 FT /note="Similar to Ralstonia solanacearum probable porin FT transmembrane protein rsc1082 or rs04105 SWALL:Q8Y0G2 FT (EMBL:AL646062) (394 aa) fasta scores: E(): 3.1e-44, FT 43.06% id in 404 aa, and to Bordetella pertussis outer FT membrane porin protein precursor SWALL:OMP_BORPE FT (SWALL:Q04064) (385 aa) fasta scores: E(): 3.1e-20, 34.18% FT id in 392 aa" FT /locus_tag="BPSS0252" FT /class="4.1.1" FT /colour=3 FT /product="putative porin membrane protein" FT misc_feature 339673..340749 FT /note="Pfam match to entry PF00267 Gram-ve_porins, FT Gram-negative porin , score -51.1, E-value 0.0003" FT /colour=9 FT CDS complement(340812..341774) FT /note="Similar to Pasteurella multocida hypothetical FT protein pm1646 SWALL:Q9CKH2 (EMBL:AE006201) (317 aa) fasta FT scores: E(): 1.2e-59, 52.68% id in 317 aa, and to Bacillus FT halodurans transcriptional regulator bh0780 SWALL:Q9KER9 FT (EMBL:AP001509) (316 aa) fasta scores: E(): 1.7e-24, FT 29.83% id in 305 aa" FT /locus_tag="BPSS0253" FT /class="7.0.0" FT /colour=13 FT /product="putative DNA-binding protein" FT misc_feature complement(341658..341723) FT /note="Predicted helix-turn-helix motif with score FT 1806.000, SD 5.34 at aa 18-39, sequence FT LTQEELAQKFAISRPKVGRLLK" FT /colour=2 FT CDS complement(341809..342303) FT /note="Similar to Escherichia coli ribose 5-phosphate FT isomerase B RpiB or b4090 SWALL:RPIB_ECOLI (SWALL:P37351) FT (149 aa) fasta scores: E(): 5.9e-21, 46.62% id in 148 aa, FT and to Yersinia pestis ribose 5-phosphate isomerase B RpiB FT or ypo3353 or y0837 SWALL:AAM84422 (EMBL:AJ414156) (151 FT aa) fasta scores: E(): 1.7e-28, 55.4% id in 148 aa" FT /locus_tag="BPSS0254" FT /class="3.3.9" FT /colour=7 FT /product="putative ribose 5-phosphate isomerase" FT misc_feature complement(341872..342114) FT /note="Pfam match to entry PF02502 LacAB_rpiB, FT Ribose/Galactose Isomerase , score 163.1, E-value 3e-46" FT /colour=9 FT CDS 342542..344059 FT /note="Similar to Escherichia coli ribose transport FT ATP-binding protein RbsA or b3749 SWALL:RBSA_ECOLI FT (SWALL:P04983) (501 aa) fasta scores: E(): 2.6e-60, 40.89% FT id in 494 aa, and to Yersinia pestis sugar transport FT ATP-binding protein ypo0858 SWALL:Q8ZHN2 (EMBL:AJ414145) FT (502 aa) fasta scores: E(): 1.6e-74, 48.77% id in 490 aa" FT /locus_tag="BPSS0255" FT /class="4.1.1" FT /colour=3 FT /product="putative ribose ABC transport system, FT ATP-binding protein" FT misc_feature 342668..343231 FT /note="Pfam match to entry PF00005 ABC_tran, ABC FT transporter , score 157.1, E-value 2e-44" FT /colour=9 FT misc_feature 342689..342712 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT misc_feature 343415..343993 FT /note="Pfam match to entry PF00005 ABC_tran, ABC FT transporter , score 113.8, E-value 2.1e-31" FT /colour=9 FT misc_feature 343766..343810 FT /colour=8 FT /note="PS00211 ABC transporters family signature." FT CDS 344068..345045 FT /note="Similar to Escherichia coli, Escherichia coli O6, FT and Escherichia coli O157:H7 ribose transport system FT permease protein RbsC or b3750 or c4678 or z5251 or FT ecs4692 SWALL:RBSC_ECOLI (SWALL:P04984) (321 aa) fasta FT scores: E(): 1.3e-45, 53.31% id in 302 aa, and to FT Salmonella typhimurium, and Salmonella typhi ABC FT superfamily stm3883 or sty3895 SWALL:Q8XFM3 FT (EMBL:AE008881) (321 aa) fasta scores: E(): 5.1e-46, FT 53.97% id in 302 aa" FT /product="putative ABC ribose transport system, permease FT protein" FT /gene="rbsC" FT /locus_tag="BPSS0256" FT /class="4.1.1" FT /colour=3 FT misc_feature 344110..345036 FT /note="Pfam match to entry PF02653 BPD_transp_2, FT Branched-chain amino acid transport system / permease FT component , score -45.1, E-value 0.00012" FT /colour=9 FT misc_feature order(344140..344208,344236..344289,344302..344361,344374..344442,344461..344514,344572..344640,344725..344793,344893..344961) FT /colour=0 FT /note="8 probable transmembrane helices predicted for FT BPSS0256 by TMHMM2.0 at aa 29-51, 61-78, 83-102, 107-129, FT 136-153, 173-195, 224-246 and 280-302" FT CDS 345077..346105 FT /note="Similar to Escherichia coli D-ribose-binding FT periplasmic protein precursor RbsB or RbsP or PrlB or FT b3751 SWALL:RBSB_ECOLI (SWALL:P02925) (296 aa) fasta FT scores: E(): 4.1e-13, 28.18% id in 298 aa, and to Brucella FT melitensis D-ribose-binding periplasmic protein precursor FT bmei0393 SWALL:Q8YIQ0 (EMBL:AE009482) (325 aa) fasta FT scores: E(): 6.3e-54, 51.09% id in 321 aa" FT /locus_tag="BPSS0257" FT /class="4.1.0" FT /colour=3 FT /product="putative ribose ABC transport system, FT substrate-binding exported protein" FT misc_feature 345077..345172 FT /note="Signal peptide predicted for BPSS0257 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.996 between residues 32 and 33" FT /colour=3 FT misc_feature 345182..346018 FT /note="Pfam match to entry PF00532 Peripla_BP_like, FT Periplasmic binding proteins and sugar binding domain of FT the LacI family , score -15.6, E-value 0.00015" FT /colour=9 FT CDS 346117..346887 FT /note="Similar to Escherichia coli 2-deoxy-D-gluconate FT 3-dehydrogenase KduD or b2842 SWALL:KDUD_ECOLI FT (SWALL:P37769) (253 aa) fasta scores: E(): 9.3e-24, 37.45% FT id in 251 aa, and to Yersinia pestis putative FT dehydrogenase ypo3351 or y0839 SWALL:Q8ZBQ6 FT (EMBL:AJ414156) (256 aa) fasta scores: E(): 1.7e-39, FT 52.17% id in 253 aa" FT /locus_tag="BPSS0258" FT /class="7.0.0" FT /colour=13 FT /product="putative dehydrogenase" FT misc_feature 346150..346875 FT /note="Pfam match to entry PF00106 adh_short, short chain FT dehydrogenase , score 265.1, E-value 5.9e-77" FT /colour=9 FT misc_feature 346561..346647 FT /colour=8 FT /note="PS00061 Short-chain dehydrogenases/reductases FT family signature." FT CDS 346953..348089 FT /note="Similar to Pseudomonas putida 2,3-butanediol FT dehydrogenase Adh SWALL:Q59696 (EMBL:L35343) (362 aa) FT fasta scores: E(): 2.8e-32, 32.12% id in 358 aa, and to FT Yersinia pestis putative zinc-binding dehydrogenase FT ypo3352 SWALL:Q8ZBQ5 (EMBL:AJ414156) (371 aa) fasta FT scores: E(): 7.9e-88, 61.51% id in 356 aa" FT /locus_tag="BPSS0259" FT /class="7.0.0" FT /colour=13 FT /product="putative dehydrogenase" FT misc_feature 347040..348080 FT /note="Pfam match to entry PF00107 adh_zinc, Zinc-binding FT dehydrogenase , score 246.5, E-value 2.5e-71" FT /colour=9 FT CDS 348094..349098 FT /note="Similar to Yersinia pestis putative FT dihydroxyacetone kinase DhaK or ypo3350 SWALL:Q8ZBQ7 FT (EMBL:AJ414156) (333 aa) fasta scores: E(): 2.1e-72, FT 62.72% id in 330 aa, and to Selenomonas ruminantium subsp. FT ruminantium dihydroxyacetone kinase DhaK1 SWALL:Q93PV9 FT (EMBL:AF297121) (329 aa) fasta scores: E(): 2.6e-45, 43.3% FT id in 321 aa" FT /locus_tag="BPSS0260" FT /class="7.0.0" FT /colour=13 FT /product="putative kinase" FT misc_feature 348121..349089 FT /note="Pfam match to entry PF02733 Dak1, Dak1 domain , FT score 259.4, E-value 3.2e-75" FT /colour=9 FT CDS 349095..349754 FT /note="Similar to the plasmid-borne Rhizobium meliloti FT putative dihydroxyacetone kinase protein rb0299 or FT smb20313 SWALL:Q92WN3 (EMBL:AL603643) (213 aa) fasta FT scores: E(): 5.6e-36, 54.93% id in 213 aa, and to FT Selenomonas ruminantium subsp. ruminantium FT dihydroxyacetone kinase DhaK2 SWALL:Q9F677 (EMBL:AF297121) FT (207 aa) fasta scores: E(): 1.2e-19, 37.18% id in 199 aa" FT /locus_tag="BPSS0261" FT /class="7.0.0" FT /colour=13 FT /product="putative kinase" FT misc_feature 349203..349730 FT /note="Pfam match to entry PF02734 Dak2, DAK2 domain , FT score 97.4, E-value 1.8e-26" FT /colour=9 FT CDS complement(349788..350261) FT /note="Similar to Salmonella typhi aminoglycoside FT 6'-N-acetyltransferase Aac or sty1445 SWALL:Q8Z762 FT (EMBL:AL627270) (172 aa) fasta scores: E(): 4.6e-23, FT 49.65% id in 145 aa, and to Enterobacter aerogenes FT aminoglycoside N AacA7 SWALL:AAC6_ENTAE (SWALL:P50858) FT (152 aa) fasta scores: E(): 9.3e-17, 43.91% id in 148 aa" FT /locus_tag="BPSS0262" FT /class="1.4.3" FT /colour=0 FT /product="putative aminoglycoside 6'-N-acetyltransferase" FT misc_feature complement(349833..350081) FT /note="Pfam match to entry PF00583 Acetyltransf, FT Acetyltransferase (GNAT) family , score 51.3, E-value FT 1.3e-12" FT /colour=9 FT CDS complement(350258..350713) FT /locus_tag="BPSS0263" FT /class="4.1.1" FT /colour=3 FT /note="No significant database matches" FT /product="putative membrane protein" FT misc_feature complement(order(350396..350449,350459..350518)) FT /colour=0 FT /note="2 probable transmembrane helices predicted for FT BPSS0263 by TMHMM2.0 at aa 66-85 and 89-106" FT CDS complement(351133..351393) FT /locus_tag="BPSS0264" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS complement(351601..352749) FT /note="Similar to Bordetella pertussis outer membrane FT porin protein precursor SWALL:OMP_BORPE (SWALL:Q04064) FT (385 aa) fasta scores: E(): 1.1e-21, 33.58% id in 405 aa, FT and to Ralstonia solanacearum probable porin signal FT peptide protein rsp0051 or rs02026 SWALL:Q8XTQ5 FT (EMBL:AL646076) (382 aa) fasta scores: E(): 1.6e-34, FT 39.75% id in 405 aa" FT /locus_tag="BPSS0265" FT /class="4.1.0" FT /colour=3 FT /product="putative porin-related protein" FT misc_feature complement(351604..352656) FT /note="Pfam match to entry PF00267 Gram-ve_porins, FT Gram-negative porin , score -40.6, E-value 0.00012" FT /colour=9 FT misc_feature complement(352495..352521) FT /colour=8 FT /note="PS00572 Glycosyl hydrolases family 1 active site." FT misc_feature complement(352690..352749) FT /note="Signal peptide predicted for BPSS0265 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.997 between residues 20 and 21" FT /colour=3 FT CDS 353062..353862 FT /note="Similar to Ralstonia solanacearum probable signal FT peptide protein rsc0922 or rs04493 SWALL:Q8Y0X1 FT (EMBL:AL646061) (266 aa) fasta scores: E(): 4.7e-57, FT 62.54% id in 259 aa, and to Brucella melitensis ABC FT transporter substrate binding protein bmei1954 FT SWALL:Q8YEC4 (EMBL:AE009628) (268 aa) fasta scores: E(): FT 7.2e-42, 46% id in 263 aa" FT /locus_tag="BPSS0266" FT /class="4.1.0" FT /colour=3 FT /product="putative exported protein" FT misc_feature 353062..353130 FT /note="Signal peptide predicted for BPSS0266 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.999 between residues 23 and 24" FT /colour=3 FT misc_feature 353140..353859 FT /note="Pfam match to entry PF03180 Lipoprotein_9, NLPA FT lipoprotein , score 401.9, E-value 4.1e-118" FT /colour=9 FT CDS complement(354335..355450) FT /note="Similar to Pseudomonas aeruginosa FT arginine/ornithine transport operon protein Aot AotO or FT pa0891 SWALL:O50184 (EMBL:AF012537) (370 aa) fasta scores: FT E(): 1.3e-51, 43.39% id in 371 aa, and to Rhizobium loti FT hypothetical protein mlr2771 SWALL:Q98HP7 (EMBL:AP003000) FT (351 aa) fasta scores: E(): 1.3e-09, 30.34% id in 379 aa" FT /locus_tag="BPSS0267" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS 355722..357836 FT /note="Similar to Rhizobium loti O-antigen acetylase FT mlr0695 SWALL:Q98M77 (EMBL:AP002995) (688 aa) fasta FT scores: E(): 1.3e-66, 42.93% id in 694 aa, and to FT Pseudomonas aeruginosa probable O-antigen acetylase pa5238 FT SWALL:Q9HTV2 (EMBL:AE004936) (662 aa) fasta scores: E(): FT 6e-32, 31.62% id in 702 aa. CDS is extended at the FT N-terminus in comparison to orthologues. Possible FT alternative translational start site" FT /locus_tag="BPSS0268" FT /class="4.1.4" FT /colour=3 FT /product="putative O-antigen acetylase" FT misc_feature 355764..355787 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT misc_feature 355860..356792 FT /note="Pfam match to entry PF01757 Acyl_transf_3, FT Acyltransferase family , score 150.9, E-value 1.5e-42" FT /colour=9 FT misc_feature order(355872..355940,356001..356069,356097..356165,356277..356336,356349..356417,356454..356522,356532..356600,356658..356726,356754..356807,356856..356924) FT /colour=0 FT /note="10 probable transmembrane helices predicted for FT BPSS0268 by TMHMM2.0 at aa 51-73, 94-116, 126-148, FT 186-205, 210-232, 245-267, 271-293, 313-335, 345-362 and FT 379-401" FT CDS 357861..357995 FT /note="No significant database matches" FT /product="hypothetical protein" FT /colour=8 FT /class="0.0.0" FT /locus_tag="BPSS0268A" FT CDS complement(358089..358871) FT /note="Similar to Escherichia coli FT lysine-arginine-ornithine-binding periplasmic protein FT precursor ArgT or b2310 SWALL:ARGT_ECOLI (SWALL:P09551) FT (260 aa) fasta scores: E(): 2.6e-52, 53.66% id in 259 aa, FT and histidine-binding periplasmic protein precursor HisJ FT or b2309 or c2851 or z3571 or ecs3193 SWALL:HISJ_ECOLI FT (SWALL:P39182) (260 aa) fasta scores: E(): 3.5e-52, 52.51% FT id in 259 aa" FT /product="lysine-arginine-ornithine transport system, FT binding exported protein" FT /gene="argT" FT /locus_tag="BPSS0269" FT /class="1.5.1" FT /colour=3 FT misc_feature complement(358107..358790) FT /note="Pfam match to entry PF00497 SBP_bac_3, Bacterial FT extracellular solute-binding proteins, family 3 , score FT 280.6, E-value 1.3e-81" FT /colour=9 FT misc_feature complement(358467..358490) FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT misc_feature complement(358683..358724) FT /colour=8 FT /note="PS01039 Bacterial extracellular solute-binding FT proteins, family 3 signature." FT misc_feature complement(358806..358871) FT /note="Signal peptide predicted for BPSS0269 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.997 between residues 24 and 25" FT /colour=3 FT CDS complement(359105..360004) FT /note="Similar to Pseudomonas aeruginosa probable FT transcriptional regulator pa2921 SWALL:Q9HZS6 FT (EMBL:AE004718) (329 aa) fasta scores: E(): 2.7e-26, 37% FT id in 300 aa, and to Escherichia coli putative FT transcriptional regulator AbgR or b1339 SWALL:ABGR_ECOLI FT (SWALL:P77744) (302 aa) fasta scores: E(): 2e-21, 29.96% FT id in 297 aa" FT /locus_tag="BPSS0270" FT /class="6.3.6" FT /colour=9 FT /product="putative LysR-family transcriptional regulator" FT misc_feature complement(359120..359749) FT /note="Pfam match to entry PF03466 LysR_substrate, LysR FT substrate binding domain , score 121.8, E-value 8.2e-34" FT /colour=9 FT misc_feature complement(359819..359998) FT /note="Pfam match to entry PF00126 HTH_1, Bacterial FT regulatory helix-turn-helix protein, lysR family , score FT 79.5, E-value 4.5e-21" FT /colour=9 FT misc_feature complement(359864..359956) FT /colour=8 FT /note="PS00044 Bacterial regulatory proteins, lysR family FT signature." FT misc_feature complement(359894..359959) FT /note="Predicted helix-turn-helix motif with score FT 1789.000, SD 5.28 at aa 16-37, sequence FT KSLRAAARALGVTQPAITHTIR" FT /colour=2 FT misc_feature complement(359960..359980) FT /colour=8 FT /note="PS00290 Immunoglobulins and major FT histocompatibility complex proteins signature." FT CDS 360140..361327 FT /note="Similar to Campylobacter jejuni hippurate hydrolase FT HipO or cj0985C SWALL:HIPO_CAMJE (SWALL:P45493) (383 aa) FT fasta scores: E(): 5.6e-56, 44.44% id in 387 aa, and to FT Agrobacterium tumefaciens amidohydrolase atu3635 or FT agr_l_2386 SWALL:Q8U9U0 (EMBL:AE009292) (430 aa) fasta FT scores: E(): 6.1e-67, 47.84% id in 395 aa" FT /locus_tag="BPSS0271" FT /class="7.0.0" FT /colour=13 FT /product="family M20D unassigned peptidase" FT misc_feature 360185..361144 FT /note="Pfam match to entry PF01546 Peptidase_M20, FT Peptidase family M20/M25/M40 , score 283.6, E-value FT 1.6e-82" FT /colour=9 FT CDS 361615..362931 FT /note="Similar to Pseudomonas aeruginosa probable MFS FT transporter pa4343 SWALL:Q9HW58 (EMBL:AE004850) (439 aa) FT fasta scores: E(): 2.3e-64, 46.82% id in 425 aa, and to FT Escherichia coli citrate-proton symporter CitA or Cit FT SWALL:CIT1_ECOLI (SWALL:P07661) (431 aa) fasta scores: FT E(): 1.3e-45, 36.77% id in 416 aa" FT /locus_tag="BPSS0272" FT /class="1.5.3" FT /colour=3 FT /product="putative transporter protein" FT misc_feature 361687..362928 FT /note="Pfam match to entry PF00083 sugar_tr, Sugar (and FT other) transporter , score 64.3, E-value 1.7e-16" FT /colour=9 FT misc_feature order(361702..361770,361813..361881,361915..361983,362206..362265,362356..362424,362467..362535,362554..362613,362641..362709,362746..362814,362842..362901) FT /colour=0 FT /note="10 probable transmembrane helices predicted for FT BPSS0272 by TMHMM2.0 at aa 30-52, 67-89, 101-123, 198-217, FT 248-270, 285-307, 314-333, 343-365, 378-400 and 410-429" FT CDS complement(363494..364213) FT /note="Similar to Escherichia coli and Escherichia coli O6 FT hypothetical transcriptional regulator YcdC or b1013 or FT c1150 SWALL:YCDC_ECOLI (SWALL:P75899) (212 aa) fasta FT scores: E(): 8.2e-22, 38.42% id in 190 aa, and to FT Pseudomonas putida transcriptional regulator, TetR family FT pp0594 SWALL:AAN66221 (EMBL:AE016776) (247 aa) fasta FT scores: E(): 8e-30, 37.39% id in 238 aa" FT /locus_tag="BPSS0273" FT /class="6.3.8" FT /colour=9 FT /product="putative TetR-family regulatory protein" FT misc_feature complement(363950..364090) FT /note="Pfam match to entry PF00440 tetR, Bacterial FT regulatory proteins, tetR family , score 65.4, E-value FT 7.9e-17" FT /colour=9 FT CDS complement(364563..365420) FT /note="Similar to Pseudomonas putida pca regulon FT regulatory protein PcaR SWALL:PCAR_PSEPU (SWALL:Q52154) FT (291 aa) fasta scores: E(): 1.8e-38, 42.85% id in 273 aa, FT and to Ralstonia solanacearum probable transcription FT regulator protein rsc2255 or rs01304 SWALL:Q8XX61 FT (EMBL:AL646069) (275 aa) fasta scores: E(): 1.2e-68, FT 67.75% id in 276 aa. Possible alternative translational FT start site" FT /locus_tag="BPSS0274" FT /class="6.3.4" FT /colour=9 FT /product="putative IclR-family transcriptional regulator" FT misc_feature complement(364581..365141) FT /note="Pfam match to entry PF01614 IclR, Bacterial FT transcriptional regulator , score 217.4, E-value 1.4e-62" FT /colour=9 FT misc_feature complement(365184..365249) FT /note="Predicted helix-turn-helix motif with score FT 1014.000, SD 2.64 at aa 58-79, sequence FT QTLTEVASATGLTRAGARRILL" FT /colour=2 FT CDS 365585..366787 FT /note="Previously sequenced as Burkholderia pseudomallei FT beta-ketoadipyl CoA thiolase PcaF SWALL:Q9F4K2 FT (EMBL:AY007371) (400 aa) fasta scores: E(): 1.8e-145, 100% FT id in 400 aa. Similar to Pseudomonas putida FT beta-ketoadipyl CoA thiolase PcaF SWALL:PCAF_PSEPU FT (SWALL:Q51956) (400 aa) fasta scores: E(): 7.4e-106, FT 73.56% id in 401 aa" FT /product="beta-ketoadipyl CoA thiolase" FT /gene="pcaF" FT /locus_tag="BPSS0275" FT /class="3.4.3" FT /colour=6 FT misc_feature 365585..366388 FT /note="Pfam match to entry PF00108 thiolase, Thiolase, FT N-terminal domain , score 332.6, E-value 2.9e-97" FT /colour=9 FT misc_feature 365840..365896 FT /colour=8 FT /note="PS00098 Thiolases acyl-enzyme intermediate FT signature." FT misc_feature 366401..366781 FT /note="Pfam match to entry PF02803 thiolase_C, Thiolase, FT C-terminal domain , score 207.0, E-value 1.9e-59" FT /colour=9 FT misc_feature 366620..366670 FT /colour=8 FT /note="PS00737 Thiolases signature 2." FT misc_feature 366725..366766 FT /colour=8 FT /note="PS00099 Thiolases active site." FT CDS 367570..369114 FT /note="Similar to Escherichia coli aerotaxis receptor Aer FT or Air or b3072 SWALL:AER_ECOLI (SWALL:P50466) (506 aa) FT fasta scores: E(): 7.6e-83, 51.65% id in 515 aa, and to FT Ralstonia solanacearum probable aerotaxis sensor receptor FT rsp1224 or rs03168 SWALL:Q8XQK0 (EMBL:AL646083) (514 aa) FT fasta scores: E(): 8.2e-120, 69.84% id in 514 aa" FT /product="aerotaxis receptor" FT /gene="aer" FT /gene="air" FT /locus_tag="BPSS0276" FT /class="1.1.1" FT /colour=0 FT misc_feature 367807..367917 FT /note="Pfam match to entry PF00785 PAC, PAC motif , score FT 22.3, E-value 7.8e-06" FT /colour=9 FT misc_feature 368080..368148 FT /colour=0 FT /note="1 probable transmembrane helix predicted for FT BPSS0276 by TMHMM2.0 at aa 171-193" FT misc_feature 368149..368358 FT /note="Pfam match to entry PF00672 HAMP, HAMP domain , FT score 21.6, E-value 0.0012" FT /colour=9 FT misc_feature 368419..369111 FT /note="Pfam match to entry PF00015 MCPsignal, FT Methyl-accepting chemotaxis protein (MCP) signaling domain FT , score 341.4, E-value 6.6e-100" FT /colour=9 FT CDS complement(369207..370223) FT /note="Similar to Streptomyces sp. JP95 putative FT methyltransferase GrhL SWALL:Q8KSX2 (EMBL:AF509565) (343 FT aa) fasta scores: E(): 2e-16, 27.32% id in 333 aa, and to FT Mycobacterium tuberculosis putative methyltransferase FT rv0567 or mt0593 or mtv039.05 SWALL:O53764 (EMBL:AL021942) FT (340 aa) fasta scores: E(): 1.1e-16, 28.03% id in 321 aa" FT /locus_tag="BPSS0277" FT /class="7.0.0" FT /colour=13 FT /product="putative methyltransferase" FT misc_feature complement(369282..370001) FT /note="Pfam match to entry PF00891 Methyltransf_2, FT O-methyltransferase , score 50.1, E-value 8.8e-13" FT /colour=9 FT CDS complement(370641..371681) FT /note="Low similarity to Pseudomonas sp. vanillate FT O-demethylase oxygenase subunit VanA SWALL:VANA_PSESP FT (SWALL:O05616) (354 aa) fasta scores: E(): 1.9e-06, 24.49% FT id in 298 aa, and to Xanthomonas campestris vanillate FT O-demethylase oxygenase subunit xcc0363 SWALL:AAM39682 FT (EMBL:AE012132) (358 aa) fasta scores: E(): 1.7e-08, FT 25.98% id in 304 aa" FT /locus_tag="BPSS0278" FT /class="7.0.0" FT /colour=13 FT /product="putative oxygenase" FT CDS complement(371678..372625) FT /note="Very low similarity to parts of Arabidopsis FT thaliana putative rieske iron-sulfur protein at2g24820 FT SWALL:Q9SK50 (EMBL:AC006585) (539 aa) fasta scores: E(): FT 8e-13, 29.8% id in 255 aa, and to Anabaena sp. FT hypothetical protein all3866 SWALL:Q8YQG5 (EMBL:AP003594) FT (351 aa) fasta scores: E(): 8.4e-10, 32.89% id in 152 aa" FT /locus_tag="BPSS0279" FT /class="7.0.0" FT /colour=13 FT /product="putative rieske iron-sulfur protein" FT misc_feature complement(372317..372598) FT /note="Pfam match to entry PF00355 Rieske, Rieske [2Fe-2S] FT domain , score 54.3, E-value 1.8e-13" FT /colour=9 FT CDS complement(374061..375530) FT /note="Similar to Escherichia coli succinate-semialdehyde FT dehydrogenase [NADP+] GabD or b2661 SWALL:GABD_ECOLI FT (SWALL:P25526) (482 aa) fasta scores: E(): 1.4e-130, 69.7% FT id in 482 aa, and to Salmonella typhi FT succinate-semialdehyde dehydrogenase sty2911 SWALL:Q8Z4F8 FT (EMBL:AL627276) (482 aa) fasta scores: E(): 7.2e-131, FT 70.12% id in 482 aa" FT /product="succinate-semialdehyde dehydrogenase [NADP+]" FT /EC_number="1.2.1.16" FT /gene="gabD" FT /locus_tag="BPSS0280" FT /class="3.3.14" FT /colour=7 FT misc_feature complement(374064..375458) FT /note="Pfam match to entry PF00171 aldedh, Aldehyde FT dehydrogenase family , score 719.4, E-value 1.1e-213" FT /colour=9 FT misc_feature complement(374631..374666) FT /colour=8 FT /note="PS00070 Aldehyde dehydrogenases cysteine active FT site." FT misc_feature complement(374727..374750) FT /colour=8 FT /note="PS00687 Aldehyde dehydrogenases glutamic acid FT active site." FT CDS complement(375588..376871) FT /note="Similar to Escherichia coli 4-aminobutyrate FT aminotransferase GabT or b2662 SWALL:GABT_ECOLI FT (SWALL:P22256) (426 aa) fasta scores: E(): 4.8e-79, 54.24% FT id in 424 aa, and to Ralstonia solanacearum probable FT 4-aminobutyrate aminotransferase protein rsc0029 or FT rs01852 SWALL:Q8Y3F1 (EMBL:AL646057) (426 aa) fasta FT scores: E(): 1.5e-108, 71.29% id in 418 aa" FT /product="4-aminobutyrate aminotransferase" FT /EC_number="2.6.1.19" FT /gene="gabT" FT /locus_tag="BPSS0281" FT /class="3.3.14" FT /colour=7 FT misc_feature complement(375603..376835) FT /note="Pfam match to entry PF00202 aminotran_3, FT Aminotransferase class-III , score 550.8, E-value FT 6.1e-163" FT /colour=9 FT misc_feature complement(376056..376169) FT /colour=8 FT /note="PS00600 Aminotransferases class-III FT pyridoxal-phosphate attachment site." FT misc_feature complement(376743..376802) FT /colour=8 FT /note="PS00636 Nt-dnaJ domain signature." FT CDS 377013..378707 FT /note="Similar to Ralstonia solanacearum putative FT transcription regulator protein rsc0030 or rs01853 FT SWALL:Q8Y3F0 (EMBL:AL646057) (509 aa) fasta scores: E(): FT 3e-74, 57.69% id in 520 aa, and to Yersinia pestis FT putative GntR-family regulatory protein ypo2845 or y1389 FT SWALL:Q8ZCW3 (EMBL:AJ414154) (501 aa) fasta scores: E(): FT 3e-61, 46.1% id in 514 aa" FT /locus_tag="BPSS0282" FT /class="6.3.3" FT /colour=9 FT /product="putative GntR-family regulatory protein" FT misc_feature 377091..377270 FT /note="Pfam match to entry PF00392 gntR, Bacterial FT regulatory proteins, gntR family , score 48.9, E-value FT 7.2e-12" FT /colour=9 FT misc_feature 377640..378563 FT /note="Pfam match to entry PF00155 aminotran_1_2, FT Aminotransferase class I and II , score 14.5, E-value FT 1.9e-07" FT /colour=9 FT CDS complement(378724..380208) FT /note="Similar to Bacillus halodurans hypothetical protein FT bh2308 SWALL:Q9KAH9 (EMBL:AP001515) (470 aa) fasta scores: FT E(): 1.9e-35, 25.87% id in 460 aa, and to Salmonella typhi FT putative membrane protein sty4802 SWALL:Q8Z128 FT (EMBL:AL627283) (467 aa) fasta scores: E(): 6.2e-19, FT 28.75% id in 480 aa" FT /locus_tag="BPSS0283" FT /class="4.1.1" FT /colour=3 FT /product="putative membrane protein" FT misc_feature complement(order(378733..378801,378838..378906,378988..379056,379117..379173,379216..379284,379429..379497,379555..379623,379657..379725,379822..379890,380038..380091)) FT /colour=0 FT /note="10 probable transmembrane helices predicted for FT BPSS0283 by TMHMM2.0 at aa 40-57, 107-129, 162-184, FT 196-218, 238-260, 309-331, 346-364, 385-407, 435-457 and FT 470-492" FT CDS complement(380274..381041) FT /note="Similar to Escherichia coli transcriptional FT regulator KdgR or b1827 SWALL:KDGR_ECOLI (SWALL:P76268) FT (263 aa) fasta scores: E(): 1.8e-15, 30.92% id in 249 aa, FT and to Bacillus halodurans transcriptional regulator FT bh2137 SWALL:Q9KAZ9 (EMBL:AP001514) (251 aa) fasta scores: FT E(): 1e-18, 31.85% id in 248 aa" FT /locus_tag="BPSS0284" FT /class="6.3.4" FT /colour=9 FT /product="putative IclR-family transcriptional regulator" FT misc_feature complement(380316..380858) FT /note="Pfam match to entry PF01614 IclR, Bacterial FT transcriptional regulator , score 123.2, E-value 3.1e-34" FT /colour=9 FT misc_feature complement(380559..380642) FT /colour=8 FT /note="PS00107 Protein kinases ATP-binding region FT signature." FT misc_feature complement(380907..380972) FT /note="Predicted helix-turn-helix motif with score FT 1495.000, SD 4.28 at aa 24-45, sequence FT LGVTELASKLGINKSRTYRMLC" FT /colour=2 FT CDS complement(381038..381946) FT /note="Similar to Rhizobium loti N-formylglutamate FT amidohydrolase mll3040 SWALL:Q98H42 (EMBL:AP003001) (313 FT aa) fasta scores: E(): 1.5e-28, 37.72% id in 273 aa, and FT to Agrobacterium tumefaciens hypothetical protein atu3884 FT or agr_l_1927 SWALL:Q8U946 (EMBL:AE009319) (294 aa) fasta FT scores: E(): 8.5e-28, 36.49% id in 274 aa" FT /locus_tag="BPSS0285" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS join(382289..382465,382467..382526,382529..382624,382678..382725,382729..382830) FT /note="Gene remnant. N-terminus is similar to the FT N-terminal region of Burkholderia pseudomallei outer FT membrane porin precursor Omp38 SWALL:Q7WZL2 FT (EMBL:AY312416) (374 aa) fasta scores: E(): 6.6e-05, FT 36.28% id in 113 aa. C-terminus is similar to the FT C-terminal region of Burkholderia pseudomallei outer FT membrane porin precursor Omp38 SWALL:Q7WZL2 FT (EMBL:AY312416) (374 aa) fasta scores: E(): 0.00059, FT 51.85% id in 54 aa. CDS contains frameshift and nonsense FT mutations and a deletion relative to the B. pseudomallei FT protein" FT /locus_tag="BPSS0285A" FT /class="4.1.3" FT /colour=11 FT /product="putative outer membrane porin precursor FT (fragment)" FT /pseudo FT CDS complement(382862..383695) FT /note="Similar to Rhizobium loti hypothetical protein FT mlr7896 SWALL:Q984Q1 (EMBL:AP003012) (278 aa) fasta FT scores: E(): 7.6e-27, 40.14% id in 269 aa, and to FT Streptomyces coelicolor putative integral membrane protein FT sco3164 or sce87.15C SWALL:Q9RKC3 (EMBL:AL939115) (281 aa) FT fasta scores: E(): 1.8e-26, 39.63% id in 275 aa" FT /locus_tag="BPSS0286" FT /class="4.1.1" FT /colour=3 FT /product="putative membrane protein" FT misc_feature complement(382865..383245) FT /note="Pfam match to entry PF00892 DUF6, Integral membrane FT protein DUF6 , score 38.5, E-value 1e-08" FT /colour=9 FT misc_feature complement(order(382937..383005,383018..383086,383120..383179,383222..383281,383300..383359,383372..383431,383468..383527,383540..383608,383627..383683)) FT /colour=0 FT /note="9 probable transmembrane helices predicted for FT BPSS0286 by TMHMM2.0 at aa 5-23, 30-52, 57-76, 89-108, FT 113-132, 139-158, 173-192, 204-226 and 231-253" FT misc_feature complement(383621..383695) FT /note="Signal peptide predicted for BPSS0286 by SignalP FT 2.0 HMM (Signal peptide probability 0.990) with cleavage FT site probability 0.435 between residues 25 and 26" FT /colour=3 FT CDS 383913..384977 FT /note="Similar to Escherichia coli selenide,water dikinase FT SelD or FdhB or b1764 SWALL:SELD_ECOLI (SWALL:P16456) (347 FT aa) fasta scores: E(): 2.8e-57, 52.6% id in 346 aa, and to FT Pseudomonas straminea selenide SelD SWALL:Q9AQI4 FT (EMBL:AB050935) (357 aa) fasta scores: E(): 4.1e-88, FT 71.42% id in 343 aa" FT /product="selenide, water dikinase" FT /EC_number="2.7.9.3" FT /gene="selD" FT /gene="fdhB" FT /locus_tag="BPSS0287" FT /class="2.2.9" FT /colour=2 FT misc_feature 383949..384404 FT /note="Pfam match to entry PF00586 AIRS, AIR synthase FT related protein, N-terminal domain , score 60.2, E-value FT 2.9e-15" FT /colour=9 FT misc_feature 384435..384968 FT /note="Pfam match to entry PF02769 AIRS_C, AIR synthase FT related protein, C-terminal domain , score 65.9, E-value FT 5.7e-17" FT /colour=9 FT CDS 386335..387396 FT /note="Similar to Ralstonia solanacearum putative purine FT nucleoside permease protein rsc0798 or rs05039 FT SWALL:Q8Y192 (EMBL:AL646061) (381 aa) fasta scores: E(): FT 2e-74, 56.32% id in 348 aa, and to Brucella melitensis FT purine nucleoside permease bmei0469 SWALL:Q8YIH5 FT (EMBL:AE009489) (345 aa) fasta scores: E(): 3.8e-56, FT 48.11% id in 318 aa" FT /locus_tag="BPSS0288" FT /class="4.1.0" FT /colour=3 FT /product="putative lipoprotein" FT misc_feature 386335..386406 FT /note="Signal peptide predicted for BPSS0288 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.945 between residues 24 and 25" FT /colour=3 FT misc_feature 386353..386385 FT /colour=8 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site." FT CDS complement(387636..387929) FT /locus_tag="BPSS0289" FT /class="4.1.0" FT /colour=3 FT /note="No significant database matches" FT /product="putative exported protein" FT misc_feature complement(387864..387929) FT /note="Signal peptide predicted for BPSS0289 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.998 between residues 22 and 23" FT /colour=3 FT CDS complement(388854..389858) FT /note="Similar to Burkholderia cepacia putative FT transcriptional regulator CeoR SWALL:Q8VL17 FT (EMBL:AY008288) (334 aa) fasta scores: E(): 8.5e-123, FT 91.01% id in 334 aa, and to Salmonella typhi putative FT transcriptional regulator sty1386 SWALL:Q8Z7A3 FT (EMBL:AL627270) (301 aa) fasta scores: E(): 8.7e-49, FT 43.79% id in 290 aa" FT /locus_tag="BPSS0290" FT /class="6.3.6" FT /colour=9 FT /product="putative LysR-family transcriptional regulator" FT misc_feature complement(388974..389600) FT /note="Pfam match to entry PF03466 LysR_substrate, LysR FT substrate binding domain , score 160.6, E-value 1.7e-45" FT /colour=9 FT misc_feature complement(389670..389849) FT /note="Pfam match to entry PF00126 HTH_1, Bacterial FT regulatory helix-turn-helix protein, lysR family , score FT 69.9, E-value 3.4e-18" FT /colour=9 FT misc_feature complement(389715..389807) FT /colour=8 FT /note="PS00044 Bacterial regulatory proteins, lysR family FT signature." FT misc_feature complement(389745..389810) FT /note="Predicted helix-turn-helix motif with score FT 1172.000, SD 3.18 at aa 17-38, sequence FT NSFTKAAETLGLPRASVTTIIQ" FT /colour=2 FT CDS 389951..390901 FT /note="C-terminal region is similar to Burkholderia FT cepacia lipase-like protein LlpE SWALL:Q8VL16 FT (EMBL:AY008288) (286 aa) fasta scores: E(): 7.8e-78, FT 74.55% id in 283 aa. C-terminus is similar to the FT C-terminal region of Ralstonia solanacearum probable FT lipase protein rsp1111 or rs02619 SWALL:Q8XQV7 FT (EMBL:AL646082) (357 aa) fasta scores: E(): 5.4e-46, 50.9% FT id in 277 aa" FT /locus_tag="BPSS0291" FT /class="7.0.0" FT /colour=13 FT /product="putative carboxylesterase" FT misc_feature 390179..390244 FT /note="Pfam match to entry PF00135 COesterase, FT Carboxylesterase , score 10.4, E-value 0.0018" FT /colour=9 FT CDS 390952..392181 FT /note="Similar to Escherichia coli, and Escherichia coli FT O157:H7 acriflavine resistance protein A precursor AcrA or FT MtcA or Lir or b0463 or z0578 or ecs0516 SWALL:ACRA_ECOLI FT (SWALL:P31223) (397 aa) fasta scores: E(): 5.3e-33, 32.98% FT id in 385 aa, and to Ralstonia solanacearum probable FT transmembrane multidrug efflux system transmembrane FT protein ys02620 or rsp1112 or rs02620 SWALL:Q8XQV6 FT (EMBL:AL646082) (438 aa) fasta scores: E(): 6.1e-78, FT 57.77% id in 405 aa" FT /locus_tag="BPSS0292" FT /class="1.5.5" FT /colour=3 FT /product="putative multidrug efflux system exported FT protein" FT misc_feature 390952..391053 FT /note="Signal peptide predicted for BPSS0292 by SignalP FT 2.0 HMM (Signal peptide probability 0.998) with cleavage FT site probability 0.518 between residues 34 and 35" FT /colour=3 FT misc_feature 391162..392037 FT /note="Pfam match to entry PF00529 HlyD, HlyD family FT secretion protein , score 173.1, E-value 3e-49" FT /colour=9 FT CDS 392243..395428 FT /note="Similar to Pseudomonas aeruginosa multidrug FT resistance protein MexB or pa0426 SWALL:MEXB_PSEAE FT (SWALL:P52002) (1046 aa) fasta scores: E(): 3e-158, 42.63% FT id in 1046 aa, and to Escherichia coli probable FT aminoglycoside efflux pump AcrD or b2470 SWALL:ACRD_ECOLI FT (SWALL:P24177) (1037 aa) fasta scores: E(): 5.4e-157, FT 41.32% id in 1038 aa" FT /locus_tag="BPSS0293" FT /class="1.5.5" FT /colour=3 FT /product="multidrug-efflux transporter protein" FT misc_feature 392249..395353 FT /note="Pfam match to entry PF00873 ACR_tran, FT AcrB/AcrD/AcrF family , score 1584.5, E-value 0" FT /colour=9 FT misc_feature order(392276..392344,393269..393328,393347..393415,393428..393496,393557..393625,393668..393736,393890..393958,394883..394942,394961..395029,395042..395110,395186..395254,395282..395350) FT /colour=0 FT /note="12 probable transmembrane helices predicted for FT BPSS0293 by TMHMM2.0 at aa 12-34, 343-362, 369-391, FT 396-418, 439-461, 476-498, 550-572, 881-900, 907-929, FT 934-956, 982-1004 and 1014-1036" FT CDS 395439..396971 FT /note="Similar to Ralstonia solanacearum putative FT outer-membrane drug efflux protein rsp1114 or rs05506 FT SWALL:Q8XQV4 (EMBL:AL646082) (508 aa) fasta scores: E(): FT 8.9e-99, 59.63% id in 493 aa, and to Pseudomonas FT aeruginosa outer membrane protein precursor OprM or OprK FT or pa0427 SWALL:OPRM_PSEAE (SWALL:Q51487) (485 aa) fasta FT scores: E(): 2.2e-39, 35.33% id in 484 aa" FT /locus_tag="BPSS0294" FT /class="1.5.5" FT /colour=3 FT /product="putative multidrug efflux system lipoprotein" FT misc_feature 395439..395531 FT /note="Signal peptide predicted for BPSS0294 by SignalP FT 2.0 HMM (Signal peptide probability 0.998) with cleavage FT site probability 0.725 between residues 31 and 32" FT /colour=3 FT misc_feature 395496..395528 FT /colour=8 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site." FT misc_feature 395691..396302 FT /note="Pfam match to entry PF02321 OEP, Outer membrane FT efflux protein , score 163.3, E-value 2.7e-46" FT /colour=9 FT misc_feature 396330..396935 FT /note="Pfam match to entry PF02321 OEP, Outer membrane FT efflux protein , score 182.3, E-value 5.1e-52" FT /colour=9 FT CDS complement(397880..399121) FT /note="Similar to Escherichia coli O157:H7 putative FT symport protein z0888 or ecs0758 SWALL:Q8X4W0 FT (EMBL:AE005251) (426 aa) fasta scores: E(): 2.6e-37, 33% FT id in 406 aa, and to Bacillus subtilis C4-dicarboxylate FT transport protein DctA or DctP SWALL:DCTA_BACSU FT (SWALL:P96603) (421 aa) fasta scores: E(): 2.4e-35, 30.53% FT id in 393 aa" FT /locus_tag="BPSS0295" FT /class="1.5.3" FT /colour=3 FT /product="putative transport related membrane protein" FT misc_feature complement(397937..399094) FT /note="Pfam match to entry PF00375 SDF, FT Sodium:dicarboxylate symporter family , score 209.7, FT E-value 2.9e-60" FT /colour=9 FT misc_feature complement(order(398021..398089,398117..398173,398399..398467,398510..398563,398645..398713,398828..398896,398933..399001,399029..399097)) FT /colour=0 FT /note="8 probable transmembrane helices predicted for FT BPSS0295 by TMHMM2.0 at aa 9-31, 41-63, 76-98, 137-159, FT 187-204, 219-241, 317-335 and 345-367" FT CDS complement(399105..399764) FT /note="Similar to Bradyrhizobium japonicum transcriptional FT regulatory protein bll4018 SWALL:BAC49283 (EMBL:AP005949) FT (230 aa) fasta scores: E(): 1.8e-26, 40.8% id in 223 aa, FT and to Thermoanaerobacter tengcongensis transcriptional FT regulator tte2558 SWALL:Q8R766 (EMBL:AE013196) (225 aa) FT fasta scores: E(): 1e-12, 31.52% id in 203 aa" FT /locus_tag="BPSS0296" FT /class="6.3.3" FT /colour=9 FT /product="putative GntR-family transcriptional regulator" FT misc_feature complement(399558..399689) FT /note="Pfam match to entry PF00392 gntR, Bacterial FT regulatory proteins, gntR family , score 38.4, E-value FT 1.7e-11" FT /colour=9 FT misc_feature complement(399612..399677) FT /note="Predicted helix-turn-helix motif with score FT 1246.000, SD 3.43 at aa 7-28, sequence FT ISHRGLAHELGVGQMPVRSALQ" FT /colour=2 FT CDS 399920..400390 FT /note="Similar to Listeria innocua hypothetical protein FT lin2871 SWALL:Q927B8 (EMBL:AL596173) (153 aa) fasta FT scores: E(): 5.2e-07, 33.61% id in 119 aa, and to Bacillus FT subtilis YitI protein SWALL:O06744 (EMBL:Z99109) (154 aa) FT fasta scores: E(): 4.6e-05, 27.48% id in 131 aa" FT /locus_tag="BPSS0297" FT /class="7.0.0" FT /colour=13 FT /product="putative acetyltransferase" FT misc_feature 400058..400306 FT /note="Pfam match to entry PF00583 Acetyltransf, FT Acetyltransferase (GNAT) family , score 56.3, E-value FT 4.2e-14" FT /colour=9 FT CDS complement(400571..401470) FT /note="Similar to Xanthomonas axonopodis hypothetical FT protein xac0191 SWALL:AAM35083 (EMBL:AE011644) (305 aa) FT fasta scores: E(): 3.3e-21, 31.86% id in 295 aa, and to FT Aquifex aeolicus hypothetical protein aq_1392 SWALL:O67397 FT (EMBL:AE000738) (292 aa) fasta scores: E(): 3e-14, 28.85% FT id in 298 aa" FT /locus_tag="BPSS0298" FT /class="1.5.5" FT /colour=3 FT /product="putative transport related membrane protein" FT misc_feature complement(order(400586..400654,400673..400741,400751..400819,400853..400921,401099..401167,401225..401293,401336..401404,401417..401461)) FT /colour=0 FT /note="8 probable transmembrane helices predicted for FT BPSS0298 by TMHMM2.0 at aa 4-18, 23-45, 60-82, 102-124, FT 184-206, 218-240, 244-266 and 273-295" FT misc_feature complement(401054..401380) FT /note="Pfam match to entry PF03547 Auxin_eff, Auxin Efflux FT Carrier , score 24.6, E-value 3.1e-06" FT /colour=9 FT CDS complement(401900..403765) FT /note="Similar to the N-terminal region of Streptomyces FT coelicolor polyketide synthase sco5892 or sc3f7.12 FT SWALL:O54155 (EMBL:AL939125) (2297 aa) fasta scores: E(): FT 2.6e-69, 41.73% id in 587 aa, and to the full length of FT Mycobacterium tuberculosis putative fatty-acid--CoA ligase FT rv1521 or mt1572 or mtcy19g5.07 SWALL:FD25_MYCTU FT (SWALL:Q50586) (583 aa) fasta scores: E(): 5.3e-56, 36.65% FT id in 592 aa" FT /locus_tag="BPSS0299" FT /class="3.8.0" FT /colour=7 FT /product="putative fatty-acid CoA ligase" FT misc_feature complement(402248..403594) FT /note="Pfam match to entry PF00501 AMP-binding, FT AMP-binding enzyme , score 226.4, E-value 2.8e-65" FT /colour=9 FT misc_feature complement(403172..403207) FT /colour=8 FT /note="PS00455 Putative AMP-binding domain signature." FT CDS complement(403782..404681) FT /note="Similar to Escherichia coli, and Escherichia coli FT O6 malonyl CoA-acyl carrier protein transacylase FabD or FT TfpA or b1092 or c1361 SWALL:FABD_ECOLI (SWALL:P25715) FT (308 aa) fasta scores: E(): 2.6e-24, 34.75% id in 305 aa, FT and to Bacillus subtilis PksC protein SWALL:O34825 FT (EMBL:Z99112) (288 aa) fasta scores: E(): 1.3e-39, 43.35% FT id in 286 aa" FT /locus_tag="BPSS0300" FT /class="3.6.1" FT /colour=7 FT /product="putative malonyl CoA-acyl carrier protein" FT misc_feature complement(403788..404678) FT /note="Pfam match to entry PF00698 Acyl_transf, Acyl FT transferase domain , score 69.3, E-value 5.4e-18" FT /colour=9 FT CDS complement(404682..405113) FT /locus_tag="BPSS0301" FT /class="4.1.1" FT /colour=3 FT /note="No significant database matches" FT /product="putative membrane protein" FT misc_feature complement(order(404694..404753,404823..404891,404901..404969)) FT /colour=0 FT /note="3 probable transmembrane helices predicted for FT BPSS0301 by TMHMM2.0 at aa 34-56, 60-82 and 106-125" FT CDS complement(405181..407040) FT /note="Similar to Escherichia coli probable FT crotonobetaine/carnitine-CoA ligase CaiC or b0037 FT SWALL:CAIC_ECOLI (SWALL:P31552) (522 aa) fasta scores: FT E(): 2.8e-37, 29.91% id in 488 aa, and to Mycobacterium FT tuberculosis putative chain fatty-acid-CoA ligase FadD13 FT or rv3089 or mtv013.10 or mt3174 SWALL:O53306 FT (EMBL:AL021309) (503 aa) fasta scores: E(): 5.9e-43, FT 32.62% id in 518 aa" FT /locus_tag="BPSS0302" FT /class="3.6.1" FT /colour=7 FT /product="putative fatty acid biosynthesis-related CoA FT ligase" FT misc_feature complement(405436..406656) FT /note="Pfam match to entry PF00501 AMP-binding, FT AMP-binding enzyme , score 415.1, E-value 4.1e-122" FT /colour=9 FT misc_feature complement(406213..406248) FT /colour=8 FT /note="PS00455 Putative AMP-binding domain signature." FT CDS complement(407070..408329) FT /note="Similar to Pseudomonas aeruginosa diaminopimelate FT decarboxylase pa5277 SWALL:DCDA_PSEAE (SWALL:P19572) (415 FT aa) fasta scores: E(): 1.6e-21, 31.68% id in 404 aa, and FT to Escherichia coli diaminopimelate decarboxylase LysA or FT b2838 SWALL:DCDA_ECOLI (SWALL:P00861) (420 aa) fasta FT scores: E(): 4.8e-19, 31.76% id in 403 aa" FT /locus_tag="BPSS0303" FT /class="3.1.13" FT /colour=7 FT /product="putative diaminopimelate decarboxylase" FT misc_feature complement(407088..407411) FT /note="Pfam match to entry PF00278 Orn_DAP_Arg_deC, FT Pyridoxal-dependent decarboxylase, C-terminal sheet domain FT , score 48.8, E-value 8e-12" FT /colour=9 FT misc_feature complement(407418..408161) FT /note="Pfam match to entry PF02784 Orn_Arg_deC_N, FT Pyridoxal-dependent decarboxylase, pyridoxal binding FT domain , score 63.3, E-value 3.4e-16" FT /colour=9 FT CDS complement(408326..409807) FT /locus_tag="BPSS0304" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS complement(409804..410859) FT /note="Similar to Bacillus subtilis ketol-acid FT reductoisomerase IlvC SWALL:ILVC_BACSU (SWALL:P37253) (342 FT aa) fasta scores: E(): 7e-27, 36.91% id in 298 aa, and to FT Neisseria meningitidis ketol-acid reductoisomerase nma1763 FT SWALL:ILVC_NEIMA (SWALL:Q9JTI3) (337 aa) fasta scores: FT E(): 9.9e-31, 35.71% id in 322 aa" FT /locus_tag="BPSS0305" FT /class="3.3.20" FT /colour=7 FT /product="putative ketol-acid reductoisomerase" FT CDS complement(410865..423266) FT /note="Similar to Xanthomonas albilineans albicidin FT multifunctional polyketide-peptide synthase XabB FT SWALL:Q9AIT3 (EMBL:AF239749) (4801 aa) fasta scores: E(): FT 1.4e-123, 36.11% id in 3458 aa, and to Bacillus subtilis FT putative polyketide synthase PksM or PksY SWALL:PKSM_BACSU FT (SWALL:P40872) (4273 aa) fasta scores: E(): 2.3e-93, 36% FT id in 2861 aa" FT /locus_tag="BPSS0306" FT /class="3.8.0" FT /colour=7 FT /product="putative multifunctional polyketide-peptide FT syntase" FT misc_feature complement(412149..412343) FT /note="Pfam match to entry PF00550 pp-binding, FT Phosphopantetheine attachment site , score 66.4, E-value FT 3.9e-17" FT /colour=9 FT misc_feature complement(412227..412274) FT /colour=8 FT /note="PS00012 Phosphopantetheine attachment site." FT misc_feature complement(413595..414494) FT /note="Pfam match to entry PF00668 Condensation, FT Condensation domain , score 157.6, E-value 1.4e-44" FT /colour=9 FT misc_feature complement(414663..414857) FT /note="Pfam match to entry PF00550 pp-binding, FT Phosphopantetheine attachment site , score 31.4, E-value FT 1.3e-06" FT /colour=9 FT misc_feature complement(415464..415982) FT /note="Pfam match to entry PF02801 ketoacyl-synt_C, FT Beta-ketoacyl synthase, C-terminal domain , score 276.3, FT E-value 2.5e-80" FT /colour=9 FT misc_feature complement(416004..416711) FT /note="Pfam match to entry PF00109 ketoacyl-synt, FT Beta-ketoacyl synthase, N-terminal domain , score 365.5, FT E-value 3.6e-107" FT /colour=9 FT misc_feature complement(416217..416267) FT /colour=8 FT /note="PS00606 Beta-ketoacyl synthases active site." FT misc_feature complement(416922..417122) FT /note="Pfam match to entry PF00550 pp-binding, FT Phosphopantetheine attachment site , score 54.0, E-value FT 2.1e-13" FT /colour=9 FT misc_feature complement(417000..417047) FT /colour=8 FT /note="PS00012 Phosphopantetheine attachment site." FT misc_feature complement(421488..422027) FT /note="Pfam match to entry PF02801 ketoacyl-synt_C, FT Beta-ketoacyl synthase, C-terminal domain , score 274.2, FT E-value 1.1e-79" FT /colour=9 FT misc_feature complement(422049..422765) FT /note="Pfam match to entry PF00109 ketoacyl-synt, FT Beta-ketoacyl synthase, N-terminal domain , score 363.9, FT E-value 1.1e-106" FT /colour=9 FT misc_feature complement(422262..422312) FT /colour=8 FT /note="PS00606 Beta-ketoacyl synthases active site." FT misc_feature complement(423021..423221) FT /note="Pfam match to entry PF00550 pp-binding, FT Phosphopantetheine attachment site , score 32.2, E-value FT 7.8e-07" FT /colour=9 FT CDS complement(423325..424737) FT /note="Similar to Bacillus subtilis betaine aldehyde FT dehydrogenase GbsA SWALL:DHAB_BACSU (SWALL:P71016) (490 FT aa) fasta scores: E(): 6.9e-59, 40.08% id in 474 aa, and FT to Salmonella typhi putative aldehyde dehydrogenase FT sty1467 SWALL:Q8Z747 (EMBL:AL627270) (481 aa) fasta FT scores: E(): 1.2e-101, 59.02% id in 471 aa" FT /locus_tag="BPSS0307" FT /class="3.6.1" FT /colour=7 FT /product="putative aldehyde dehydrogenase" FT misc_feature complement(423328..424719) FT /note="Pfam match to entry PF00171 aldedh, Aldehyde FT dehydrogenase family , score 569.6, E-value 1.4e-168" FT /colour=9 FT misc_feature complement(423898..423933) FT /colour=8 FT /note="PS00070 Aldehyde dehydrogenases cysteine active FT site." FT misc_feature complement(423994..424017) FT /colour=8 FT /note="PS00687 Aldehyde dehydrogenases glutamic acid FT active site." FT misc_feature complement(424057..424080) FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT CDS complement(424731..426152) FT /note="Similar to Rhizobium loti aminotransferase mll3663 FT SWALL:Q98FQ6 (EMBL:AP003002) (472 aa) fasta scores: E(): FT 4.5e-88, 48.42% id in 444 aa, and to Pseudomonas FT aeruginosa probable class III aminotransferase pa4805 FT SWALL:Q9HV04 (EMBL:AE004893) (468 aa) fasta scores: E(): FT 4.9e-82, 47.21% id in 449 aa" FT /locus_tag="BPSS0308" FT /class="3.8.0" FT /colour=7 FT /product="putative aminotransferase" FT misc_feature complement(424782..426077) FT /note="Pfam match to entry PF00202 aminotran_3, FT Aminotransferase class-III , score 325.3, E-value 4.5e-95" FT /colour=9 FT misc_feature complement(425268..425384) FT /colour=8 FT /note="PS00600 Aminotransferases class-III FT pyridoxal-phosphate attachment site." FT CDS complement(426161..427240) FT /note="Similar to Pseudomonas syringae syringomycin FT biosynthesis enzyme SyrP SWALL:P97053 (EMBL:U88574) (353 FT aa) fasta scores: E(): 2.4e-22, 31.43% id in 334 aa, and FT to Streptomyces verticillus SyrP-like protein SWALL:Q9FB16 FT (EMBL:AF210249) (339 aa) fasta scores: E(): 1.8e-21, FT 29.51% id in 332 aa" FT /locus_tag="BPSS0309" FT /class="7.0.0" FT /colour=13 FT /product="putative peptide synthase regulatory protein" FT CDS complement(428238..428756) FT /locus_tag="BPSS0310" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS complement(428856..437384) FT /note="Similar to Microcystis aeruginosa peptide FT synthetase and polyketide synthase McyG SWALL:Q9FDT8 FT (EMBL:AB032549) (2632 aa) fasta scores: E(): 1.9e-45, FT 25.62% id in 2420 aa, and to Ralstonia solanacearum FT probable polyketide synthase protein rsc1810 or rs04235 FT SWALL:Q8XYE8 (EMBL:AL646066) (2380 aa) fasta scores: E(): FT 1.5e-46, 29.7% id in 2013 aa" FT /locus_tag="BPSS0311" FT /class="3.8.0" FT /colour=7 FT /product="putative multifunctional polyketide-peptide FT syntase" FT misc_feature complement(428925..429035) FT /note="Pfam match to entry PF00550 pp-binding, FT Phosphopantetheine attachment site , score 15.4, E-value FT 0.00082" FT /colour=9 FT misc_feature complement(428967..429014) FT /colour=8 FT /note="PS00012 Phosphopantetheine attachment site." FT misc_feature complement(429861..429893) FT /colour=8 FT /note="PS00136 Serine proteases, subtilase family, FT aspartic acid active site." FT misc_feature complement(430026..430103) FT /colour=8 FT /note="PS00217 Sugar transport proteins signature 2." FT misc_feature complement(430803..431498) FT /note="Pfam match to entry PF00975 Thioesterase, FT Thioesterase domain , score 19.3, E-value 3e-05" FT /colour=9 FT misc_feature complement(431904..432953) FT /note="Pfam match to entry PF00698 Acyl_transf, Acyl FT transferase domain , score 148.2, E-value 9.7e-42" FT /colour=9 FT misc_feature complement(433293..433850) FT /note="Pfam match to entry PF02801 ketoacyl-synt_C, FT Beta-ketoacyl synthase, C-terminal domain , score 233.6, FT E-value 1.9e-67" FT /colour=9 FT misc_feature complement(433872..434636) FT /note="Pfam match to entry PF00109 ketoacyl-synt, FT Beta-ketoacyl synthase, N-terminal domain , score 230.3, FT E-value 1.8e-66" FT /colour=9 FT misc_feature complement(434082..434132) FT /colour=8 FT /note="PS00606 Beta-ketoacyl synthases active site." FT misc_feature complement(434724..434918) FT /note="Pfam match to entry PF00550 pp-binding, FT Phosphopantetheine attachment site , score 64.3, E-value FT 1.6e-16" FT /colour=9 FT misc_feature complement(434787..434828) FT /colour=8 FT /note="PS00105 Aminotransferases class-I FT pyridoxal-phosphate attachment site." FT misc_feature complement(434802..434849) FT /colour=8 FT /note="PS00012 Phosphopantetheine attachment site." FT misc_feature complement(435210..436436) FT /note="Pfam match to entry PF00501 AMP-binding, FT AMP-binding enzyme , score 299.2, E-value 3.2e-87" FT /colour=9 FT misc_feature complement(436041..436076) FT /colour=8 FT /note="PS00455 Putative AMP-binding domain signature." FT misc_feature complement(436623..437330) FT /note="Pfam match to entry PF00975 Thioesterase, FT Thioesterase domain , score 143.8, E-value 1.9e-40" FT /colour=9 FT CDS 438602..439306 FT /note="Similar to Vibrio anguillarum transcriptional FT activator protein VanR SWALL:VANR_VIBAN (SWALL:P74946) FT (240 aa) fasta scores: E(): 2e-21, 34.32% id in 201 aa, FT and to Ralstonia solanacearum transcriptional activator FT protein SolR or rsc3287 or rs02516 SWALL:SLR1_RALSO FT (SWALL:P58590) (236 aa) fasta scores: E(): 2.2e-22, 37.76% FT id in 233 aa" FT /locus_tag="BPSS0312" FT /class="6.3.11" FT /colour=9 FT /product="putative LuxR-family transcriptional regulator" FT misc_feature 438641..439081 FT /note="Pfam match to entry PF03472 Autoind_bind, FT Autoinducer binding domain , score 109.4, E-value 4.4e-30" FT /colour=9 FT misc_feature 439112..439303 FT /note="Pfam match to entry PF00196 GerE, Bacterial FT regulatory proteins, luxR family , score 67.6, E-value FT 1.7e-17" FT /colour=9 FT misc_feature 439163..439246 FT /colour=8 FT /note="PS00622 Bacterial regulatory proteins, luxR family FT signature." FT misc_feature 439166..439231 FT /note="Predicted helix-turn-helix motif with score FT 1440.000, SD 4.09 at aa 189-210, sequence FT KTAWEISKILGISERTVVFHLS" FT /colour=2 FT CDS 439636..440475 FT /note="Similar to Pasteurella haemolytica outer membrane FT lipoprotein 2 precursor PlpB SWALL:PLPB_PASHA FT (SWALL:Q08869) (276 aa) fasta scores: E(): 4.2e-28, 40.69% FT id in 231 aa, and to Escherichia coli O157:H7 FT D-methionine-binding lipoprotein precursor MetQ or z0209 FT or ecs0199 SWALL:Q8X8V9 (EMBL:AE005195) (271 aa) fasta FT scores: E(): 4.8e-28, 40.24% id in 246 aa" FT /locus_tag="BPSS0313" FT /class="4.1.0" FT /colour=3 FT /product="putative lipoprotein" FT misc_feature 439636..439746 FT /note="Signal peptide predicted for BPSS0313 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.954 between residues 37 and 38" FT /colour=3 FT misc_feature 439756..440472 FT /note="Pfam match to entry PF03180 Lipoprotein_9, NLPA FT lipoprotein , score 323.3, E-value 1.8e-94" FT /colour=9 FT CDS 440493..441887 FT /note="Similar to Rhodococcus sp. dibenzothiophene FT desulfurization enzyme A SoxA or DdszA SWALL:SOXA_RHOSG FT (SWALL:P54995) (453 aa) fasta scores: E(): 5.2e-52, 38.32% FT id in 454 aa" FT /locus_tag="BPSS0314" FT /class="7.0.0" FT /colour=13 FT /product="putative monooxygenase" FT CDS 441956..443098 FT /note="Similar to Escherichia coli D-methionine transport FT ATP-binding protein MetN or Abc or b0199 SWALL:METN_ECOLI FT (SWALL:P30750) (343 aa) fasta scores: E(): 6.1e-42, 46.32% FT id in 354 aa, and to Pseudomonas putida ABC transporter, FT ATP-binding protein pp0220 SWALL:AAN65852 (EMBL:AE016774) FT (369 aa) fasta scores: E(): 5.1e-52, 53.03% id in 379 aa" FT /locus_tag="BPSS0315" FT /class="4.1.1" FT /colour=3 FT /product="putative ABC transport system, ATP-binding FT protein" FT misc_feature 442115..442675 FT /note="Pfam match to entry PF00005 ABC_tran, ABC FT transporter , score 232.0, E-value 5.5e-67" FT /colour=9 FT misc_feature 442136..442159 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT misc_feature 442445..442489 FT /colour=8 FT /note="PS00211 ABC transporters family signature." FT CDS 443091..443747 FT /note="Similar to Pseudomonas aeruginosa probable permease FT of ABC transporter pa2351 SWALL:Q9I1C7 (EMBL:AE004661) FT (217 aa) fasta scores: E(): 5.6e-52, 68.66% id in 217 aa, FT and to Brucella melitensis ABC transporter permease FT protein bmeii0336 SWALL:Q8YD41 (EMBL:AE009671) (230 aa) FT fasta scores: E(): 3.7e-47, 62.21% id in 217 aa" FT /locus_tag="BPSS0316" FT /class="4.1.1" FT /colour=3 FT /product="putative ACB transport system, membrane protein" FT misc_feature order(443148..443216,443250..443318,443331..443399,443523..443591,443649..443708) FT /colour=0 FT /note="5 probable transmembrane helices predicted for FT BPSS0316 by TMHMM2.0 at aa 20-42, 54-76, 81-103, 145-167 FT and 187-206" FT misc_feature 443421..443633 FT /note="Pfam match to entry PF00528 BPD_transp, FT Binding-protein-dependent transport systems inner membrane FT component , score 60.1, E-value 3.2e-15" FT /colour=9 FT misc_feature 443424..443510 FT /colour=8 FT /note="PS00402 Binding-protein-dependent transport systems FT inner membrane comp. sign." FT CDS 444511..445713 FT /note="Similar to Pseudomonas aeruginosa probable FT FMNH2-dependent monooxygenase pa2355 SWALL:Q9I1C3 FT (EMBL:AE004661) (394 aa) fasta scores: E(): 3.6e-63, FT 46.03% id in 391 aa, and to Rhodococcus sp. FT dibenzothiophene desulfurization enzyme C SoxC or DszC FT SWALL:SOXC_RHOSO (SWALL:P54998) (417 aa) fasta scores: FT E(): 5.9e-34, 41.04% id in 402 aa" FT /locus_tag="BPSS0317" FT /class="7.0.0" FT /colour=13 FT /product="putative monooxygenase" FT misc_feature 445204..445677 FT /note="Pfam match to entry PF00441 Acyl-CoA_dh, Acyl-CoA FT dehydrogenase, C-terminal domain , score -9.5, E-value FT 8.3e-05" FT /colour=9 FT CDS complement(445815..446642) FT /locus_tag="BPSS0318" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS complement(446938..447537) FT /locus_tag="BPSS0319" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS complement(447574..448293) FT /note="Similar to Escherichia coli, Escherichia coli O6, FT and Escherichia coli O157:H7 pyruvate dehydrogenase FT complex repressor PdhR or GenA or AceC or b0113 or c0140 FT or z0123 or ecs0117 SWALL:PDHR_ECOLI (SWALL:P06957) (254 FT aa) fasta scores: E(): 3.5e-24, 39.48% id in 233 aa, and FT to Yersinia pestis transcriptional regulator for pyruvate FT dehydrogenase complex y0766 SWALL:AAM84353 (EMBL:AE013678) FT (278 aa) fasta scores: E(): 9.3e-25, 38.75% id in 240 aa" FT /locus_tag="BPSS0320" FT /class="6.3.3" FT /colour=9 FT /product="putative GntR-family transcriptional regulator" FT misc_feature complement(448063..448242) FT /note="Pfam match to entry PF00392 gntR, Bacterial FT regulatory proteins, gntR family , score 85.5, E-value FT 6.9e-23" FT /colour=9 FT misc_feature complement(448111..448185) FT /colour=8 FT /note="PS00043 Bacterial regulatory proteins, gntR family FT signature." FT misc_feature complement(448117..448182) FT /note="Predicted helix-turn-helix motif with score FT 1149.000, SD 3.10 at aa 129-150, sequence FT PTERELAAQLNVSRPSLREALV" FT /colour=2 FT CDS 448742..449548 FT /note="Similar to Escherichia coli hypothetical protein FT YkgE or b0306 SWALL:YKGE_ECOLI (SWALL:P77252) (239 aa) FT fasta scores: E(): 5.7e-35, 43.03% id in 237 aa, and to FT Ralstonia solanacearum hypothetical protein rsc1611 or FT rs03974 SWALL:Q8XYZ5 (EMBL:AL646065) (241 aa) fasta FT scores: E(): 5.5e-50, 56.25% id in 240 aa. Note: This CDS FT is longer in its N-terminal region than most of its FT database matches" FT /locus_tag="BPSS0321" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT misc_feature 448868..449044 FT /note="Pfam match to entry PF02754 DUF224, Domain of FT unknown function (DUF224) , score 52.4, E-value 6.6e-13" FT /colour=9 FT misc_feature 449261..449449 FT /note="Pfam match to entry PF02754 DUF224, Domain of FT unknown function (DUF224) , score 37.3, E-value 2.4e-08" FT /colour=9 FT CDS 449545..450993 FT /note="Similar to Ralstonia solanacearum putative FT iron-sulfur binding protein rsc1612 or rs03975 FT SWALL:Q8XYZ4 (EMBL:AL646065) (469 aa) fasta scores: E(): FT 3.2e-76, 46.45% id in 465 aa, and to Pasteurella multocida FT hypothetical protein pm1854 SWALL:Q9CJY4 (EMBL:AE006223) FT (467 aa) fasta scores: E(): 9.4e-67, 41.59% id in 464 aa" FT /locus_tag="BPSS0322" FT /class="7.0.0" FT /colour=13 FT /product="putative iron-sulfur binding protein" FT misc_feature 450475..450546 FT /note="Pfam match to entry PF00037 fer4, 4Fe-4S binding FT domain , score 19.2, E-value 0.00017" FT /colour=9 FT misc_feature 450496..450531 FT /colour=8 FT /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding FT region signature." FT misc_feature 450625..450696 FT /note="Pfam match to entry PF00037 fer4, 4Fe-4S binding FT domain , score 9.0, E-value 0.0067" FT /colour=9 FT CDS 450990..451715 FT /note="C-terminus is similar to the C-terminal regions of FT Ralstonia solanacearum putative transmembrane protein FT rsc1032 or rs04218 SWALL:Q8Y0L1 (EMBL:AL646062) (243 aa) FT fasta scores: E(): 7.3e-15, 41.11% id in 180 aa, and FT Bacillus subtilis YvbY protein SWALL:O32259 (EMBL:Z99121) FT (240 aa) fasta scores: E(): 3.6e-07, 30.86% id in 162 aa" FT /locus_tag="BPSS0323" FT /class="0.0.0" FT /colour=8 FT /product="hypothetical protein" FT misc_feature 451326..451703 FT /note="Pfam match to entry PF02589 DUF162, Uncharacterized FT ACR, YkgG family COG1556 , score 47.1, E-value 2.6e-11" FT /colour=9 FT CDS 452083..453801 FT /note="Similar to Escherichia coli glycolate permease GlcA FT or b2975 SWALL:GLCA_ECOLI (SWALL:Q46839) (560 aa) fasta FT scores: E(): 3.4e-77, 68.47% id in 571 aa, and to FT Escherichia coli L-lactate permease LldP or LctP or b3603 FT SWALL:LLDP_ECOLI (SWALL:P33231) (551 aa) fasta scores: FT E(): 3.5e-65, 59.47% id in 570 aa" FT /product="glycolate permease" FT /gene="glcA" FT /locus_tag="BPSS0324" FT /class="1.5.3" FT /colour=3 FT misc_feature order(452119..452187,452200..452268,452287..452355,452464..452532,452551..452619,452662..452721,452740..452808,452836..452889,452926..452994,453037..453090,453109..453165,453244..453312,453370..453438,453448..453516,453727..453795) FT /colour=0 FT /note="15 probable transmembrane helices predicted for FT BPSS0324 by TMHMM2.0 at aa 13-35, 40-62, 69-91, 128-150, FT 157-179, 194-213, 220-242, 252-269, 282-304, 319-336, FT 343-361, 388-410, 430-452, 456-478 and 549-571" FT misc_feature 452128..453768 FT /note="Pfam match to entry PF02652 Lactate_perm, L-lactate FT permease , score 964.7, E-value 1.5e-287" FT /colour=9 FT CDS 454103..454540 FT /note="Similar to Escherichia coli hypothetical protein FT YphA or b2543 SWALL:YPHA_ECOLI (SWALL:P77751) (140 aa) FT fasta scores: E(): 8.9e-16, 40.32% id in 124 aa, and to FT Ralstonia solanacearum probable transmembrane protein FT rsc2500 or rs01095 SWALL:Q8XWH4 (EMBL:AL646070) (136 aa) FT fasta scores: E(): 2.5e-14, 42.85% id in 119 aa" FT /locus_tag="BPSS0325" FT /class="4.1.1" FT /colour=3 FT /product="putative membrane protein" FT misc_feature order(454121..454180,454238..454306,454325..454393,454436..454495) FT /colour=0 FT /note="4 probable transmembrane helices predicted for FT BPSS0325 by TMHMM2.0 at aa 7-26, 46-68, 75-97 and 112-131" FT CDS complement(454731..456302) FT /note="Similar (appart from the internal repeat region) FT the plasmid-borne Streptomyces coelicolor methylenomycin A FT resistance protein Mmr or scp1.237C SWALL:MMR_STRCO FT (SWALL:P11545) (475 aa) fasta scores: E(): 7.2e-20, 32.75% FT id in 464 aa, and to Rhizobium loti probable transporter FT mll2542 SWALL:Q98I66 (EMBL:AP002999) (505 aa) fasta FT scores: E(): 8.6e-22, 32.99% id in 494 aa. The effect of FT the extra internal amino acids on the function of protein FT is not known" FT /locus_tag="BPSS0326" FT /class="1.5.5" FT /colour=3 FT /product="putative transport-related membrane protein" FT misc_feature complement(order(454776..454844,454872..454925,454986..455054,455082..455135,455154..455222,455265..455333,455391..455459,455721..455780,455799..455867,455973..456041,456078..456146,456174..456242)) FT /colour=0 FT /note="12 probable transmembrane helices predicted for FT BPSS0326 by TMHMM2.0 at aa 21-43, 53-75, 88-110, 146-168, FT 175-194, 282-304, 324-346, 361-383, 390-407, 417-439, FT 460-477 and 487-509" FT misc_feature complement(455946..456095) FT /note="Pfam match to entry PF00083 sugar_tr, Sugar (and FT other) transporter , score 18.8, E-value 7.4e-06" FT /colour=9 FT CDS complement(456588..457880) FT /note="Similar to Pseudomonas aeruginosa probable MFS FT transporter pa5370 SWALL:Q9HTJ4 (EMBL:AE004949) (438 aa) FT fasta scores: E(): 1.6e-109, 66.82% id in 425 aa, and to FT Agrobacterium tumefaciens MFS permease[proline/betaine] FT TphA or atu2154 or agr_c_3904 SWALL:Q8UDH1 (EMBL:AE009165) FT (443 aa) fasta scores: E(): 1.5e-88, 55.76% id in 416 aa" FT /locus_tag="BPSS0327" FT /class="1.5.5" FT /colour=3 FT /product="putative sugar transport-related, membrane FT protein" FT misc_feature complement(order(456606..456665,456678..456746,456783..456851,456864..456932,456951..457019,457062..457130,457233..457292,457335..457403,457428..457496,457509..457577,457614..457682,457740..457808)) FT /colour=0 FT /note="12 probable transmembrane helices predicted for FT BPSS0327 by TMHMM2.0 at aa 25-47, 67-89, 102-124, 129-151, FT 160-182, 197-216, 251-273, 288-310, 317-339, 344-366, FT 379-401 and 406-425" FT misc_feature complement(456606..457811) FT /note="Pfam match to entry PF00083 sugar_tr, Sugar (and FT other) transporter , score 54.9, E-value 1.1e-13" FT /colour=9 FT CDS complement(458196..459230) FT /note="Similar to Methanothermus fervidus FT malate/L-sulfolactate dehydrogenase Mdh SWALL:MDH_METFE FT (SWALL:P16142) (339 aa) fasta scores: E(): 6.7e-22, 31.76% FT id in 277 aa, and to Pseudomonas aeruginosa hypothetical FT oxidoreductase pa1252 SWALL:YC52_PSEAE (SWALL:Q9I492) (334 FT aa) fasta scores: E(): 5.2e-77, 61.56% id in 333 aa" FT /locus_tag="BPSS0328" FT /class="7.0.0" FT /colour=13 FT /product="putative malate/L-lactate dehydrogenase" FT misc_feature complement(458205..459197) FT /note="Pfam match to entry PF02615 ldh_2, Malate/L-lactate FT dehydrogenase , score 148.4, E-value 8.4e-42" FT /colour=9 FT CDS complement(459223..460815) FT /note="Similar to Caulobacter crescentus fatty aldehyde FT dehydrogenase cc2791 SWALL:Q9A4N9 (EMBL:AE005944) (528 aa) FT fasta scores: E(): 6.8e-120, 65.7% id in 522 aa, and to FT Vibrio harveyi fatty aldehyde dehydrogenase AldH FT SWALL:DHAF_VIBHA (SWALL:Q56694) (510 aa) fasta scores: FT E(): 1.5e-76, 47.22% id in 504 aa. Note: Also similar to FT BPSS0034 (527 aa) fasta scores: E(): 7.3e-87, 60.803% FT identity in 523 aa overlap" FT /locus_tag="BPSS0329" FT /class="3.4.5" FT /colour=6 FT /product="putative fatty aldehyde dehydrogenase" FT misc_feature complement(459370..460758) FT /note="Pfam match to entry PF00171 aldedh, Aldehyde FT dehydrogenase family , score -129.3, E-value 5.9e-10" FT /colour=9 FT CDS complement(460891..462516) FT /note="Similar to Xanthomonas campestris amino acid FT permease YveA or xcc2406 SWALL:AAM41684 (EMBL:AE012351) FT (528 aa) fasta scores: E(): 4.7e-138, 70.19% id in 520 aa, FT and to Ralstonia solanacearum probable amino-acid permease FT transmembrane protein rsp0282 or rs03682 SWALL:Q8XT33 FT (EMBL:AL646077) (543 aa) fasta scores: E(): 4.4e-69, FT 38.47% id in 512 aa. Note: This CDS is longer in its FT N-terminal region than most of its database matches" FT /locus_tag="BPSS0330" FT /class="1.5.1" FT /colour=3 FT /product="putative amino-acid permease membrane protein" FT misc_feature complement(order(460942..460995,461005..461073,461134..461187,461197..461265,461302..461370,461383..461451,461551..461619,461686..461754,461791..461859,461917..461985,462004..462072,462136..462204,462265..462333,462361..462429)) FT /colour=0 FT /note="14 probable transmembrane helices predicted for FT BPSS0330 by TMHMM2.0 at aa 30-52, 62-84, 105-127, 149-171, FT 178-200, 220-242, 255-277, 300-322, 356-378, 383-405, FT 418-440, 444-461, 482-504 and 508-525" FT misc_feature complement(461128..462441) FT /note="Pfam match to entry PF00324 aa_permeases, Amino FT acid permease , score -147.8, E-value 1.3e-06" FT /colour=9 FT CDS complement(462961..463881) FT /note="Similar to Prochlorococcus marinus FT dihydrodipicolinate synthase DapA SWALL:DAPA_PROMA FT (SWALL:P49423) (302 aa) fasta scores: E(): 1.1e-19, 30.24% FT id in 291 aa, and to Pseudomonas aeruginosa probable FT dihydrodipicolinate synthetase pa1254 SWALL:Q9I490 FT (EMBL:AE004555) (305 aa) fasta scores: E(): 3.3e-92, FT 73.52% id in 306 aa" FT /locus_tag="BPSS0331" FT /class="3.3.20" FT /colour=7 FT /product="putative dihydrodipicolinate synthase" FT misc_feature complement(462997..463863) FT /note="Pfam match to entry PF00701 DHDPS, FT Dihydrodipicolinate synthetase family , score 172.3, FT E-value 5.2e-49" FT /colour=9 FT CDS 464132..465064 FT /note="Similar to Pseudomonas aeruginosa hypothetical FT protein pa1268 SWALL:Q9I476 (EMBL:AE004556) (314 aa) fasta FT scores: E(): 1.1e-84, 71.79% id in 312 aa, and to FT Xanthomonas axonopodis hypothetical protein xac2550 FT SWALL:AAM37401 (EMBL:AE011895) (312 aa) fasta scores: E(): FT 5e-64, 57.82% id in 313 aa" FT /locus_tag="BPSS0332" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS 465061..466194 FT /note="Similar to Xanthomonas campestris D-amino acid FT oxidase xcc2414 SWALL:AAM41692 (EMBL:AE012352) (389 aa) FT fasta scores: E(): 7.1e-63, 53.84% id in 364 aa, and to FT Rhizobium meliloti opine oxidase subunit B OoxB FT SWALL:OOB2_RHIME (SWALL:P72299) (371 aa) fasta scores: FT E(): 1.2e-08, 26.24% id in 381 aa" FT /locus_tag="BPSS0333" FT /class="7.0.0" FT /colour=13 FT /product="putative oxidase" FT misc_feature 465076..466122 FT /note="Pfam match to entry PF01266 DAO, FAD dependent FT oxidoreductase , score -27.4, E-value 1.8e-06" FT /colour=9 FT CDS 466191..466424 FT /note="Similar to Xanthomonas campestris sarcosine oxidase FT alpha subunit SoxA or xcc2413 SWALL:AAM41691 FT (EMBL:AE012352) (81 aa) fasta scores: E(): 3.1e-08, 48.61% FT id in 72 aa, and to Pseudomonas aeruginosa hydrogen FT cyanide synthase HcnA or pa2193 SWALL:Q9REV9 FT (EMBL:AF208523) (104 aa) fasta scores: E(): 1.3e-07, FT 45.33% id in 75 aa" FT /locus_tag="BPSS0334" FT /class="7.0.0" FT /colour=13 FT /product="putative oxidase" FT misc_feature 466197..466397 FT /note="Pfam match to entry PF00111 fer2, 2Fe-2S FT iron-sulfur cluster binding domain , score 12.8, E-value FT 0.0018" FT /colour=9 FT CDS 466421..467713 FT /note="Similar to Rhizobium meliloti opine oxidase subunit FT A OoxA or ra1200 or sma2225 SWALL:OOA1_RHIME FT (SWALL:Q92XP4) (458 aa) fasta scores: E(): 3.2e-06, 32.88% FT id in 450 aa, and to Xanthomonas campestris oxidoreductase FT xcc2412 SWALL:AAM41690 (EMBL:AE012352) (444 aa) fasta FT scores: E(): 4.9e-58, 48.15% id in 434 aa" FT /locus_tag="BPSS0335" FT /class="7.0.0" FT /colour=13 FT /product="putative oxidoreductase" FT misc_feature 466445..467317 FT /note="Pfam match to entry PF00070 pyr_redox, Pyridine FT nucleotide-disulphide oxidoreductase , score 69.7, E-value FT 4.1e-18" FT /colour=9 FT CDS 467905..468621 FT /note="Similar to Pseudomonas aeruginosa probable FT transcriptional regulator pa1261 SWALL:Q9I483 FT (EMBL:AE004555) (224 aa) fasta scores: E(): 6.8e-51, FT 58.48% id in 224 aa, and to Xanthomonas axonopodis FT transcriptional regulator xac2551 SWALL:Q8PJI0 FT (EMBL:AE011895) (226 aa) fasta scores: E(): 1.5e-38, FT 45.53% id in 224 aa" FT /locus_tag="BPSS0336" FT /class="6.3.2" FT /colour=9 FT /product="putative AraC-family transcriptional regulator" FT misc_feature 468310..468447 FT /note="Pfam match to entry PF00165 HTH_AraC, Bacterial FT regulatory helix-turn-helix proteins, araC family , score FT 30.9, E-value 1.9e-06" FT /colour=9 FT misc_feature 468346..468411 FT /note="Predicted helix-turn-helix motif with score FT 1559.000, SD 4.50 at aa 200-221, sequence FT LNLKHLAGMAGMSVAQLERYFH" FT /colour=2 FT misc_feature 468454..468579 FT /colour=8 FT /note="PS00041 Bacterial regulatory proteins, araC family FT signature." FT misc_feature 468463..468594 FT /note="Pfam match to entry PF00165 HTH_AraC, Bacterial FT regulatory helix-turn-helix proteins, araC family , score FT 46.7, E-value 3.4e-11" FT /colour=9 FT CDS complement(468818..469087) FT /locus_tag="BPSS0337" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS complement(469303..470526) FT /note="Similar to Shigella flexneri putative transposase FT for IS110 s0128 SWALL:Q9AFS5 (EMBL:AF348706) (398 aa) FT fasta scores: E(): 3e-111, 76.73% id in 404 aa, and to FT Streptomyces coelicolor insertion element IS110 FT hypothetical 43.6 kDa protein SWALL:YIS1_STRCO FT (SWALL:P19780) (405 aa) fasta scores: E(): 3.9e-75, 58.71% FT id in 390 aa. Note: Also similar to BPSS1472 (428 aa) FT fasta scores: E(): 9.1e-117, 88.732% identity in 426 aa FT overlap" FT /product="putative insertion element protein" FT /locus_tag="BPSS0338" FT /class="5.1.4" FT /colour=12 FT misc_feature complement(469435..469758) FT /note="Pfam match to entry PF02371 Transposase_20, FT Transposase IS116/IS110/IS902 family , score 118.4, FT E-value 8.9e-33" FT /colour=9 FT misc_feature complement(469981..470277) FT /note="Pfam match to entry PF01548 Transposase_9, FT Transposase , score 108.4, E-value 8.9e-30" FT /colour=9 FT CDS complement(470668..472722) FT /note="Similar to Pseudomonas putida FT 4-hydroxyphenylpyruvate dioxygenase, putative pp2554 FT SWALL:AAN68163 (EMBL:AE016783) (635 aa) fasta scores: E(): FT 2.8e-61, 53.44% id in 683 aa. CDS contains region with FT additional internal amino acids (residues 272 to 338) in FT comparison to orthologues" FT /locus_tag="BPSS0339" FT /class="3.4.2" FT /colour=6 FT /product="putative amino acid dioxygenase" FT misc_feature complement(470866..471207) FT /note="Pfam match to entry PF00903 Glyoxalase, FT Glyoxalase/Bleomycin resistance protein/Dioxygenase FT superfamily , score 17.5, E-value 6.8e-05" FT /colour=9 FT misc_feature complement(470986..471033) FT /colour=8 FT /note="PS00063 Aldo/keto reductase family putative active FT site signature." FT CDS 472982..473437 FT /note="Similar to Streptomyces coelicolor 3-dehydroquinate FT dehydratase AroQ or sco1961 or scc54.21C SWALL:AROQ_STRCO FT (SWALL:P15474) (156 aa) fasta scores: E(): 7.9e-35, 60.92% FT id in 151 aa, and to Pseudomonas aeruginosa FT 3-dehydroquinate dehydratase 2 AroQ2 or pa0245 FT SWALL:ARQ2_PSEAE (SWALL:Q9I6P3) (148 aa) fasta scores: FT E(): 4e-32, 63.5% id in 137 aa. Note: Also similar to FT BPSL2982 AroQ1 (150 aa) fasta scores: E(): 4.2e-26, FT 56.296% identity in 135 aa overlap" FT /product="3-dehydroquinate dehydratase" FT /EC_number="4.2.1.10" FT /gene="aroQ2" FT /locus_tag="BPSS0340" FT /class="3.3.20" FT /colour=7 FT misc_feature 472991..473422 FT /note="Pfam match to entry PF01220 DHquinase_II, FT Dehydroquinase class II , score 276.9, E-value 1.7e-80" FT /colour=9 FT misc_feature 473006..473059 FT /colour=8 FT /note="PS01029 Dehydroquinase class II signature." FT CDS 473434..474288 FT /note="Similar to Corynebacterium glutamicum shikimate FT 5-dehydrogenase AroE or cgl0424 SWALL:AROE_CORGL FT (SWALL:Q9X5C9) (280 aa) fasta scores: E(): 8.9e-36, 48.39% FT id in 281 aa, and to Ralstonia solanacearum probable FT shikimate 5-dehydrogenase oxidoreductase protein rsp1398 FT or rs02060 SWALL:Q8XQ88 (EMBL:AL646084) (315 aa) fasta FT scores: E(): 3.2e-68, 72.92% id in 277 aa" FT /product="shikimate 5-dehydrogenase" FT /EC_number="1.1.1.25" FT /gene="aroE" FT /locus_tag="BPSS0341" FT /class="3.3.20" FT /colour=7 FT misc_feature 473500..474234 FT /note="Pfam match to entry PF01488 Shikimate_DH, Shikimate FT / quinate 5-dehydrogenase , score 158.7, E-value 6.7e-45" FT /colour=9 FT CDS 474336..475682 FT /note="Similar to Ralstonia solanacearum putative FT glucarate transporter GudP or rsp0828 or rs05367 FT SWALL:Q8XRK3 (EMBL:AL646081) (450 aa) fasta scores: E(): FT 9.1e-73, 44.14% id in 444 aa, and to Escherichia coli, and FT Escherichia coli O6 D-galactonate transporter DgoT or FT b3691 or c4612 SWALL:DGOT_ECOLI (SWALL:P31457) (430 aa) FT fasta scores: E(): 9.8e-71, 46.26% id in 428 aa" FT /locus_tag="BPSS0342" FT /class="1.5.3" FT /colour=3 FT /product="putative sugar transport-related, membrane FT protein" FT misc_feature 474429..475676 FT /note="Pfam match to entry PF00083 sugar_tr, Sugar (and FT other) transporter , score -85.0, E-value 7.6e-05" FT /colour=9 FT misc_feature order(474435..474503,474522..474590,474633..474701,474819..474887,474900..474959,475104..475172,475215..475283,475317..475385,475401..475469,475506..475574,475587..475655) FT /colour=0 FT /note="11 probable transmembrane helices predicted for FT BPSS0342 by TMHMM2.0 at aa 34-56, 63-85, 100-122, 162-184, FT 189-208, 257-279, 294-316, 328-350, 356-378, 391-413 and FT 418-440" FT CDS complement(476085..477194) FT /note="Similar to Pseudomonas putida putative FT 2aep:pyruvate aminotransferase PhnW SWALL:Q8RSQ4 FT (EMBL:AJ437001) (369 aa) fasta scores: E(): 2.3e-80, FT 59.83% id in 366 aa, and to Salmonella typhimurium PhnW or FT stm0431 SWALL:P96060 (EMBL:U69493) (367 aa) fasta scores: FT E(): 2.9e-55, 44.23% id in 364 aa" FT /locus_tag="BPSS0343" FT /class="3.4.2" FT /colour=6 FT /product="putative aminotransferase protein" FT misc_feature complement(476145..477167) FT /note="Pfam match to entry PF00266 aminotran_5, FT Aminotransferase class-V , score -37.2, E-value 1.6e-06" FT /colour=9 FT CDS 477432..478514 FT /note="Similar to Salmonella typhi probable periplasmic FT binding component of 2-aminoethylphosphonate transporter FT PhnS or sty0468 SWALL:Q8Z8W7 (EMBL:AL627266) (337 aa) FT fasta scores: E(): 1.8e-31, 37.03% id in 324 aa, and to FT Pyrococcus furiosus putative solute binding lipoprotein FT pf1751 SWALL:Q9HH27 (EMBL:AF307052) (357 aa) fasta scores: FT E(): 2.2e-19, 29.26% id in 352 aa" FT /locus_tag="BPSS0344" FT /class="4.1.0" FT /colour=3 FT /product="putative exported protein" FT misc_feature 477432..477527 FT /note="Signal peptide predicted for BPSS0344 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.491 between residues 32 and 33" FT /colour=3 FT misc_feature 477552..478505 FT /note="Pfam match to entry PF01547 SBP_bac_1, Bacterial FT extracellular solute-binding protein , score 34.3, E-value FT 1.8e-07" FT /colour=9 FT CDS 478571..479668 FT /note="Similar to Agrobacterium tumefaciens ABC FT transporter, nucleotide binding/ATPase protein AfuC or FT atu4786 or agr_l_193 SWALL:Q8U6M1 (EMBL:AE009407) (353 aa) FT fasta scores: E(): 7e-41, 40.4% id in 349 aa, and to FT Brucella melitensis iron(III)-transport ATP-binding FT protein bmeii0567 SWALL:Q8YCG3 (EMBL:AE009693) (353 aa) FT fasta scores: E(): 2.6e-40, 44.59% id in 305 aa" FT /locus_tag="BPSS0345" FT /class="4.1.1" FT /colour=3 FT /product="putative ABC transport system, ATP-binding FT protein" FT misc_feature 478730..479284 FT /note="Pfam match to entry PF00005 ABC_tran, ABC FT transporter , score 213.9, E-value 1.6e-61" FT /colour=9 FT misc_feature 478751..478774 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT misc_feature 479051..479095 FT /colour=8 FT /note="PS00211 ABC transporters family signature." FT CDS 479646..480593 FT /note="Similar to Salmonella typhimurium PhnU or stm0427 FT SWALL:P96064 (EMBL:U69493) (286 aa) fasta scores: E(): FT 5.1e-28, 36.78% id in 261 aa, and to Brucella melitensis FT iron(III)-transport system permease protein bmeii0585 FT SWALL:Q8YCE6 (EMBL:AE009695) (448 aa) fasta scores: E(): FT 2.7e-14, 32.28% id in 285 aa. CDS is extended at the FT N-terminus in comparison to orthologues" FT /locus_tag="BPSS0346" FT /class="4.1.1" FT /colour=3 FT /product="putative ABC transport system, membrane protein" FT misc_feature order(479778..479846,479937..480005,480042..480110,480168..480227,480348..480416,480474..480542) FT /colour=0 FT /note="6 probable transmembrane helices predicted for FT BPSS0346 by TMHMM2.0 at aa 45-67, 98-120, 133-155, FT 175-194, 235-257 and 277-299" FT misc_feature 480246..480467 FT /note="Pfam match to entry PF00528 BPD_transp, FT Binding-protein-dependent transport systems inner membrane FT component , score 47.7, E-value 1.7e-11" FT /colour=9 FT misc_feature 480249..480335 FT /colour=8 FT /note="PS00402 Binding-protein-dependent transport systems FT inner membrane comp. sign." FT CDS 480583..481437 FT /note="Similar to Salmonella typhimurium PhnV or stm0426 FT SWALL:P96065 (EMBL:U69493) (265 aa) fasta scores: E(): FT 2.7e-22, 34.97% id in 243 aa, and to Rhizobium meliloti FT putative spermidine putrescine ABC transporter permease FT protein PotC or rb0779 or smb21275 SWALL:Q92VC9 FT (EMBL:AL603644) (259 aa) fasta scores: E(): 5.8e-13, FT 30.54% id in 239 aa" FT /locus_tag="BPSS0347" FT /class="4.1.1" FT /colour=3 FT /product="putative ABC transport system, membrane protein" FT misc_feature order(480670..480738,480847..480915,480952..481020,481048..481116,481228..481296,481339..481407) FT /colour=0 FT /note="6 probable transmembrane helices predicted for FT BPSS0347 by TMHMM2.0 at aa 30-52, 89-111, 124-146, FT 156-178, 216-238 and 253-275" FT misc_feature 481111..481341 FT /note="Pfam match to entry PF00528 BPD_transp, FT Binding-protein-dependent transport systems inner membrane FT component , score 21.2, E-value 0.0005" FT /colour=9 FT misc_feature 481114..481200 FT /colour=8 FT /note="PS00402 Binding-protein-dependent transport systems FT inner membrane comp. sign." FT CDS 481481..482752 FT /note="Similar to Pseudomonas fluorescens phosphonoacetate FT hydrolase PhnA SWALL:Q51782 (EMBL:L49465) (407 aa) fasta FT scores: E(): 1.5e-94, 60.48% id in 410 aa, and to FT Rhizobium meliloti putative phosphonoacetate hydrolase FT protein rb0978 or smb21538 SWALL:Q92UV8 (EMBL:AL603645) FT (424 aa) fasta scores: E(): 3.1e-85, 56.06% id in 412 aa" FT /locus_tag="BPSS0348" FT /class="3.3.13" FT /colour=7 FT /product="putativephosphonoacetate hydrolase" FT CDS 482758..484203 FT /note="Similar to Streptococcus mutans NADP-dependent FT glyceraldehyde-3-phosphate dehydrogenase GapN or smu.676 FT SWALL:GAPN_STRMU (SWALL:Q59931) (475 aa) fasta scores: FT E(): 3.5e-48, 35.32% id in 453 aa, and to Methanobacterium FT thermoautotrophicum NADP-dependent FT glyceraldehyde-3-phosphate dehydrogenase mth978 FT SWALL:O27059 (EMBL:AE000871) (455 aa) fasta scores: E(): FT 8.9e-58, 42.3% id in 442 aa. Note: Also similar to FT BPSS0607 (491 aa) fasta scores: E(): 2.8e-91, 59.244% FT identity in 476 aa overlap" FT /locus_tag="BPSS0349" FT /class="3.2.11" FT /colour=7 FT /product="putative NADP-dependent FT glyceraldehyde-3-phosphate dehydrogenase" FT misc_feature 482800..484197 FT /note="Pfam match to entry PF00171 aldedh, Aldehyde FT dehydrogenase family , score 361.8, E-value 4.8e-106" FT /colour=9 FT misc_feature 483457..483480 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT misc_feature 483514..483537 FT /colour=8 FT /note="PS00687 Aldehyde dehydrogenases glutamic acid FT active site." FT misc_feature 483598..483633 FT /colour=8 FT /note="PS00070 Aldehyde dehydrogenases cysteine active FT site." FT CDS 484208..484759 FT /note="Similar to Anabaena sp. hypothetical protein FT all2220 SWALL:Q8YUW1 (EMBL:AP003588) (186 aa) fasta FT scores: E(): 2.9e-29, 47.54% id in 183 aa, and to FT Pseudomonas aeruginosa hypothetical protein pa2804 FT SWALL:Q9I039 (EMBL:AE004707) (193 aa) fasta scores: E(): FT 1.4e-25, 49.71% id in 175 aa" FT /locus_tag="BPSS0350" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT rRNA 485360..486852 FT /note="16S rRNA" FT /label=16S rRNA FT tRNA 486946..487022 FT /note="tRNA Ile anticodon GAT, Cove score 93.29" FT tRNA 487057..487132 FT /note="tRNA Ala anticodon TGC, Cove score 90.89" FT rRNA 487486..490367 FT /note="23S rRNA" FT /label=23S rRNA FT rRNA 490549..490664 FT /note="5S rRNA" FT /label=5S rRNA FT CDS 491060..491464 FT /note="Similar to Escherichia coli transcriptional FT regulator CueR or b0487 SWALL:CUER_ECOLI (SWALL:P77565) FT (135 aa) fasta scores: E(): 4.6e-18, 44.27% id in 131 aa, FT and to Rhizobium meliloti transcriptional regulator HmrR FT SWALL:HMRR_RHIME (SWALL:Q9X5X4) (147 aa) fasta scores: FT E(): 1.9e-30, 65.35% id in 127 aa" FT /locus_tag="BPSS0351" FT /class="6.3.12" FT /colour=9 FT /product="putative copper-related MerR-family FT transcriptional regulator" FT misc_feature 491060..491125 FT /note="Predicted helix-turn-helix motif with score FT 1203.000, SD 3.28 at aa 11-32, sequence FT VNIGEAAKVSGVSAKMIRYYES" FT /colour=2 FT misc_feature 491069..491137 FT /colour=8 FT /note="PS00552 Bacterial regulatory proteins, merR family FT signature." FT misc_feature 491069..491176 FT /note="Pfam match to entry PF00376 merR, Bacterial FT regulatory proteins, merR family , score 57.7, E-value FT 1.7e-14" FT /colour=9 FT CDS complement(492322..493167) FT /note="Similar to Escherichia coli hypothetical protein FT YhiR or b3499 SWALL:YHIR_ECOLI (SWALL:P37634) (280 aa) FT fasta scores: E(): 7.5e-46, 48.28% id in 263 aa, and to FT Ralstonia solanacearum hypothetical protein rsc3368 or FT rs02643 SWALL:Q8XU26 (EMBL:AL646075) (285 aa) fasta FT scores: E(): 1.4e-73, 62.1% id in 285 aa" FT /locus_tag="BPSS0352" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS complement(493316..494287) FT /note="Similar to the C-terminal region of Homo sapiens FT voltage-gated potassium channel beta-2 subunit KCNAB2 or FT KCNA2b or KCNK2 SWALL:KVB2_HUMAN (SWALL:Q13303) (367 aa) FT fasta scores: E(): 4.2e-56, 45.79% id in 321 aa, and to FT Xanthomonas campestris voltage-gated potassium channel FT beta subunit XCC0766 SWALL:AAM40081 (EMBL:AE012176) (322 FT aa) fasta scores: E(): 5.7e-62, 52.97% id in 319 aa" FT /locus_tag="BPSS0353" FT /class="1.5.2" FT /colour=3 FT /product="putative potassium channel subunit" FT misc_feature complement(493325..494269) FT /note="Pfam match to entry PF00248 aldo_ket_red, Aldo/keto FT reductase family , score 247.6, E-value 1.2e-71" FT /colour=9 FT CDS 494475..495263 FT /note="Similar to Rhizobium meliloti FT D-beta-hydroxybutyrate dehydrogenase BdhA or rb1136 or FT smb21010 SWALL:BDHA_RHIME (SWALL:O86034) (258 aa) fasta FT scores: E(): 5.6e-27, 40.45% id in 262 aa, and to FT Alcaligenes eutrophus D-beta-hydroxybutyrate dehydrogenase FT HbdH1 SWALL:BDHA_ALCEU (SWALL:Q9X6U2) (258 aa) fasta FT scores: E(): 1.7e-22, 36.68% id in 259 aa. Note: Also FT similar to BPSS0017 (262 aa) fasta scores: E(): 3.7e-83, FT 99.615% identity in 260 aa overlap" FT /locus_tag="BPSS0354" FT /class="3.4.3" FT /colour=6 FT /product="putative D-beta-hydroxybutyrate dehydrogenase" FT misc_feature 494490..495251 FT /note="Pfam match to entry PF00106 adh_short, short chain FT dehydrogenase , score 236.2, E-value 3.1e-68" FT /colour=9 FT misc_feature 494904..494990 FT /colour=8 FT /note="PS00061 Short-chain dehydrogenases/reductases FT family signature." FT CDS complement(495489..496688) FT /note="Similar to Escherichia coli aromatic-amino-acid FT aminotransferase TyrB or b4054 SWALL:TYRB_ECOLI FT (SWALL:P04693) (397 aa) fasta scores: E(): 1.3e-80, 54.63% FT id in 399 aa, and to Pseudomonas aeruginosa aspartate FT aminotransferase AspC or pa3139 SWALL:AAT_PSEAE FT (SWALL:P72173) (398 aa) fasta scores: E(): 2.6e-111, FT 73.86% id in 398 aa. Note: Also similar to BPSS0808 (401 FT aa) fasta scores: E(): 7.1e-72, 53.149% identity in 397 aa FT overlap" FT /product="aromatic-amino-acid aminotransferase" FT /EC_number="2.6.1.57" FT /gene="tyrB" FT /locus_tag="BPSS0355" FT /class="3.3.20" FT /colour=7 FT misc_feature complement(495495..496445) FT /note="Pfam match to entry PF00155 aminotran_1_2, FT Aminotransferase class I and II , score 336.2, E-value FT 2.4e-98" FT /colour=9 FT misc_feature complement(495915..495956) FT /colour=8 FT /note="PS00105 Aminotransferases class-I FT pyridoxal-phosphate attachment site." FT CDS 496976..499066 FT /note="Similar to Escherichia coli, and Escherichia coli FT O157:H7 excinuclease ABC subunit B UvrB or b0779 or z0998 FT or ecs0857 SWALL:UVRB_ECOLI (SWALL:P07025) (673 aa) fasta FT scores: E(): 6.3e-155, 66.17% id in 671 aa, and to FT Burkholderia cepacia excinuclease ABC subunit B UvrB FT SWALL:Q93LP1 (EMBL:AY036068) (697 aa) fasta scores: E(): FT 0, 94.52% id in 694 aa" FT /product="excinuclease ABC subunit B" FT /gene="uvrB" FT /locus_tag="BPSS0356" FT /class="2.2.11" FT /colour=2 FT misc_feature 497150..497173 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT misc_feature 498440..498670 FT /note="Pfam match to entry PF00271 helicase_C, Helicase FT conserved C-terminal domain , score 70.1, E-value 3.1e-18" FT /colour=9 FT misc_feature 498914..499021 FT /note="Pfam match to entry PF02151 UVR, UvrB/uvrC motif , FT score 45.6, E-value 7.4e-11" FT /colour=9 FT CDS 499290..499841 FT /note="Similar to Brucella melitensis 19 kDa periplasmic FT protein bmeii0885 SWALL:Q8YBL4 (EMBL:AE009722) (185 aa) FT fasta scores: E(): 2.8e-42, 61.62% id in 185 aa, and to FT Brucella suis membrane antigen, putative bra0381 FT SWALL:AAN33579 (EMBL:AE014537) (182 aa) fasta scores: E(): FT 4.4e-42, 67.27% id in 165 aa" FT /locus_tag="BPSS0357" FT /class="4.1.0" FT /colour=3 FT /product="putative exported protein" FT misc_feature 499290..499361 FT /note="Signal peptide predicted for BPSS0357 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.997 between residues 34 and 35" FT /colour=3 FT CDS 499901..500230 FT /note="Similar to Brucella melitensis hypothetical protein FT bmeii0884 SWALL:Q8YBL5 (EMBL:AE009722) (124 aa) fasta FT scores: E(): 2.2e-13, 46.29% id in 108 aa, and to FT Rickettsia conorii hypothetical protein rc0541 FT SWALL:Q92I79 (EMBL:AE008615) (126 aa) fasta scores: E(): FT 2.7e-07, 38.27% id in 81 aa" FT /locus_tag="BPSS0358" FT /class="4.1.0" FT /colour=3 FT /product="putative exported protein" FT misc_feature 499901..499963 FT /note="Signal peptide predicted for BPSS0358 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 1.000 between residues 21 and 22" FT /colour=3 FT misc_feature 499901..500158 FT /colour=8 FT /note="PS00430 TonB-dependent receptor proteins signature FT 1." FT CDS 500290..501132 FT /note="Similar to Escherichia coli hypothetical protein FT YcdN or b1016/b1017 SWALL:YCDN_ECOLI (SWALL:P75901) (276 FT aa) fasta scores: E(): 5e-17, 30.28% id in 284 aa, and to FT Brucella melitensis high-affinity iron permease bmeii0883 FT SWALL:Q8YBL6 (EMBL:AE009722) (278 aa) fasta scores: E(): FT 6.8e-49, 53.58% id in 265 aa" FT /locus_tag="BPSS0359" FT /class="4.1.1" FT /colour=3 FT /product="putative membrane protein" FT misc_feature 500290..501105 FT /note="Pfam match to entry PF03239 FTR1, Iron permease FT FTR1 family , score 50.8, E-value 2e-12" FT /colour=9 FT misc_feature order(500299..500367,500404..500472,500500..500568,500629..500697,500740..500808,500845..500898,501031..501084) FT /colour=0 FT /note="7 probable transmembrane helices predicted for FT BPSS0359 by TMHMM2.0 at aa 4-26, 39-61, 71-93, 114-136, FT 151-173, 186-203 and 248-265" FT CDS 501129..502529 FT /note="Similar to Brucella melitensis nitrogen fixation FT protein VnfA bmeii0882 SWALL:Q8YBL7 (EMBL:AE009722) (457 FT aa) fasta scores: E(): 3.1e-104, 54.08% id in 453 aa, and FT to the C-terminal region of Anabaena sp. nitrogen FT assimilation regulatory protein all3558 SWALL:Q8YR90 FT (EMBL:AP003593) (841 aa) fasta scores: E(): 7.5e-11, FT 27.25% id in 466 aa" FT /locus_tag="BPSS0360" FT /class="4.1.1" FT /colour=3 FT /product="putative membrane protein" FT misc_feature order(501201..501269,501312..501380,501477..501545,501555..501614,501936..502004,502137..502205,502242..502310,502353..502421,502455..502523) FT /colour=0 FT /note="9 probable transmembrane helices predicted for FT BPSS0360 by TMHMM2.0 at aa 25-47, 62-84, 117-139, 143-162, FT 270-292, 337-359, 372-394, 409-431 and 443-465" FT CDS 502589..502999 FT /note="Similar to Escherichia coli, and Escherichia coli FT O6 protein GlcG or b2977 or c3706 SWALL:GLCG_ECOLI FT (SWALL:P45504) (134 aa) fasta scores: E(): 1.9e-20, 49.24% FT id in 132 aa, and to Pseudomonas aeruginosa hypothetical FT protein pa5352 SWALL:Q9HTK6 (EMBL:AE004947) (133 aa) fasta FT scores: E(): 6.9e-22, 53.38% id in 133 aa" FT /locus_tag="BPSS0361" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT misc_feature 502598..502984 FT /note="Pfam match to entry PF03928 DUF336, Domain of FT unknown function (DUF336) , score 160.7, E-value 1.7e-45" FT /colour=9 FT CDS complement(503302..503565) FT /note="Low similarity to Ralstonia solanacearum putative FT hemin uptake protein HemP or rsc1966 or rs03540 FT SWALL:Q8XXZ7 (EMBL:AL646067) (92 aa) fasta scores: E(): FT 0.0018, 39.02% id in 82 aa" FT /locus_tag="BPSS0362" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS complement(503709..504194) FT /note="Similar to Ralstonia solanacearum hypothetical FT protein rsc1364 or rs04646 SWALL:Q8XZN1 (EMBL:AL646064) FT (156 aa) fasta scores: E(): 3.5e-24, 49.67% id in 155 aa, FT and to Pseudomonas aeruginosa hypothetical protein pa1206 FT SWALL:Q9I4D2 (EMBL:AE004550) (157 aa) fasta scores: E(): FT 6e-14, 38.81% id in 152 aa" FT /locus_tag="BPSS0363" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS complement(504313..505185) FT /note="Similar to Streptomyces coelicolor possible FT chromosome condensation protein sco3798 or scac2.06C FT SWALL:Q9F320 (EMBL:AL939117) (325 aa) fasta scores: E(): FT 1.5e-47, 45.39% id in 293 aa, and to Lycopersicon FT esculentum pirin-like protein SWALL:PIRL_LYCES FT (SWALL:Q9SEE4) (291 aa) fasta scores: E(): 4.2e-45, 45.93% FT id in 283 aa" FT /locus_tag="BPSS0364" FT /class="7.0.0" FT /colour=13 FT /product="putative chromosome condensation protein" FT misc_feature complement(504427..505122) FT /note="Pfam match to entry PF02678 DUF209, Uncharacterized FT BCR, YhhW family COG1741 , score -43.9, E-value 3.3e-08" FT /colour=9 FT CDS 505308..506279 FT /note="Similar to Xanthomonas axonopodis transcriptional FT regulator xac1655 SWALL:AAM36523 (EMBL:AE011797) (333 aa) FT fasta scores: E(): 1.4e-49, 45.39% id in 315 aa, and to FT Yersinia pestis lysr-family transcriptional regulatory FT protein ypo2150 SWALL:Q8ZEL4 (EMBL:AJ414151) (301 aa) FT fasta scores: E(): 4.5e-45, 43.33% id in 300 aa. Note: FT This CDS contains two possible alternative start codons at FT residues 8 or 18" FT /locus_tag="BPSS0365" FT /class="6.3.6" FT /colour=9 FT /product="putative LysR-family transcriptional regulator" FT misc_feature 505329..505508 FT /note="Pfam match to entry PF00126 HTH_1, Bacterial FT regulatory helix-turn-helix protein, lysR family , score FT 72.4, E-value 6.2e-19" FT /colour=9 FT misc_feature 505368..505433 FT /note="Predicted helix-turn-helix motif with score FT 1203.000, SD 3.28 at aa 28-49, sequence FT GGFSAAERVLGISKSRLSRRLT" FT /colour=2 FT misc_feature 505578..506207 FT /note="Pfam match to entry PF03466 LysR_substrate, LysR FT substrate binding domain , score 163.8, E-value 1.9e-46" FT /colour=9 FT CDS complement(506662..507084) FT /note="Similar to Xanthomonas campestris biopolymer FT transport protein ExbD1 or xcc0010 SWALL:EXB1_XANCP FT (SWALL:O34259) (140 aa) fasta scores: E(): 4.8e-18, 43.18% FT id in 132 aa, and to Ralstonia solanacearum probable FT biopolymer transport transmembrane protein rsc1965 or FT rs03539 SWALL:Q8XXZ8 (EMBL:AL646067) (137 aa) fasta FT scores: E(): 4.7e-30, 61.76% id in 136 aa" FT /locus_tag="BPSS0366" FT /class="1.5.5" FT /colour=3 FT /product="putative biopolymer transport protein" FT misc_feature complement(506677..507057) FT /note="Pfam match to entry PF02472 ExbD, Biopolymer FT transport protein ExbD/TolR , score 84.2, E-value 1.7e-22" FT /colour=9 FT misc_feature complement(506953..507021) FT /colour=0 FT /note="1 probable transmembrane helix predicted for FT BPSS0366 by TMHMM2.0 at aa 22-44" FT CDS complement(507104..507832) FT /note="Similar to Xanthomonas campestris biopolymer FT transport protein ExbB or xcc0009 SWALL:EXBB_XANCP FT (SWALL:O34260) (253 aa) fasta scores: E(): 1.3e-30, 42.46% FT id in 219 aa, and to Pseudomonas aeruginosa TolQ protein FT or pa0969 SWALL:TOLQ_PSEAE (SWALL:P50598) (231 aa) fasta FT scores: E(): 1.7e-15, 30.95% id in 210 aa" FT /locus_tag="BPSS0367" FT /class="1.5.5" FT /colour=3 FT /product="putative bipolymer transport protein" FT misc_feature complement(507188..507601) FT /note="Pfam match to entry PF01618 MotA_ExbB, FT MotA/TolQ/ExbB proton channel family , score 146.5, FT E-value 3e-41" FT /colour=9 FT misc_feature complement(order(507233..507301,507380..507448,507722..507790)) FT /colour=0 FT /note="3 probable transmembrane helices predicted for FT BPSS0367 by TMHMM2.0 at aa 15-37, 129-151 and 178-200" FT CDS complement(507869..508564) FT /note="Similar to Ralstonia solanacearum probable TonB FT transmembrane protein or rsc1963 or rs03537 SWALL:Q8XY00 FT (EMBL:AL646067) (221 aa) fasta scores: E(): 5.8e-10, FT 35.71% id in 238 aa, and to Bordetella bronchiseptica TonB FT SWALL:Q9ZG18 (EMBL:AF087669) (268 aa) fasta scores: E(): FT 2.4e-06, 33.86% id in 251 aa" FT /locus_tag="BPSS0368" FT /class="1.5.0" FT /colour=3 FT /product="putative TonB-like transport protein" FT misc_feature complement(508007..508111) FT /note="Pfam match to entry PF03544 TonB, Gram-negative FT bacterial tonB protein , score 40.4, E-value 2.6e-09" FT /colour=9 FT misc_feature complement(508508..508564) FT /note="Signal peptide predicted for BPSS0368 by SignalP FT 2.0 HMM (Signal peptide probability 0.828) with cleavage FT site probability 0.315 between residues 19 and 20" FT /colour=3 FT CDS complement(508840..509079) FT /note="Similar to Escherichia coli, and Escherichia coli FT O6 bacterioferritin-associated ferredoxin Bfd or b3337 or FT c4108 SWALL:BFD_ECOLI (SWALL:P13655) (64 aa) fasta scores: FT E(): 0.002, 35.84% id in 53 aa, and to Ralstonia FT solanacearum putative bacterioferritin-associated FT ferredoxin protein rsc0349 or rs03316 SWALL:Q8Y2I7 FT (EMBL:AL646058) (91 aa) fasta scores: E(): 6.3e-07, 45.45% FT id in 55 aa. CDS is extended at the C-terminus in FT comparison to orthologues" FT /locus_tag="BPSS0369" FT /class="1.6.3" FT /colour=0 FT /product="putative bacterioferritin ferredoxin protein" FT CDS complement(509211..510083) FT /note="Similar to Pediococcus pentosaceus glutamate FT racemase MurI SWALL:MURI_PEDPE (SWALL:Q08783) (265 aa) FT fasta scores: E(): 1.1e-24, 33.2% id in 265 aa, and to FT Escherichia coli glutamate racemase MurI or Dga or Glr or FT b3967 SWALL:MURI_ECOLI (SWALL:P22634) (285 aa) fasta FT scores: E(): 6.4e-23, 37.75% id in 249 aa" FT /locus_tag="BPSS0370" FT /class="4.1.2" FT /colour=3 FT /product="putative glutamate racemase" FT misc_feature complement(509391..510032) FT /note="Pfam match to entry PF01177 Asp_Glu_race, FT Asp/Glu/Hydontoin racemase , score 208.6, E-value 6.3e-60" FT /colour=9 FT misc_feature complement(509481..509513) FT /colour=8 FT /note="PS00924 Aspartate and glutamate racemases signature FT 2." FT misc_feature complement(509814..509840) FT /colour=8 FT /note="PS00923 Aspartate and glutamate racemases signature FT 1." FT CDS complement(510130..510606) FT /note="Similar to Azotobacter vinelandii bacterioferritin FT Bfr SWALL:BFR_AZOVI (SWALL:P22759) (156 aa) fasta scores: FT E(): 3.7e-38, 68.83% id in 154 aa, and to Serratia FT marcescens bacterioferritin Bfr SWALL:BFR_SERMA FT (SWALL:O68935) (159 aa) fasta scores: E(): 1.2e-32, 59.74% FT id in 154 aa" FT /product="bacterioferritin" FT /gene="bfr" FT /locus_tag="BPSS0371" FT /class="1.6.3" FT /colour=0 FT misc_feature complement(510175..510585) FT /note="Pfam match to entry PF00210 ferritin, Ferritin-like FT domain , score 170.0, E-value 2.6e-48" FT /colour=9 FT CDS complement(510761..512296) FT /note="Similar to Escherichia coli, and Escherichia coli FT O6 fumarate hydratase class I, aerobic FumA or b1612 or FT c2004 SWALL:FUMA_ECOLI (SWALL:P00923) (547 aa) fasta FT scores: E(): 1.1e-29, 33.89% id in 472 aa, and to FT Ralstonia solanacearum probable fumarate hydratase protein FT rsc1955 or rs03529 SWALL:Q8XY08 (EMBL:AL646067) (507 aa) FT fasta scores: E(): 1.3e-168, 85.51% id in 511 aa" FT /locus_tag="BPSS0372" FT /class="3.5.8" FT /colour=1 FT /product="putative fumarate hydratase" FT CDS complement(512336..512944) FT /note="Similar to Escherichia coli, and Escherichia coli FT O157:H7 hypothetical protein YqhA or b3002 or z4355 or FT ecs3886 SWALL:YQHA_ECOLI (SWALL:P52082) (164 aa) fasta FT scores: E(): 8.3e-22, 37.65% id in 162 aa, and to FT Ralstonia solanacearum probable transmembrane protein FT rsc1954 or rs03528 SWALL:Q8XY09 (EMBL:AL646067) (179 aa) FT fasta scores: E(): 6.6e-50, 78.78% id in 165 aa" FT /locus_tag="BPSS0373" FT /class="4.1.1" FT /colour=3 FT /product="putative membrane protein" FT misc_feature complement(512405..512896) FT /note="Pfam match to entry PF03350 UPF0114, FT Uncharacterized protein family, UPF0114 , score 244.4, FT E-value 1.1e-70" FT /colour=9 FT misc_feature complement(order(512429..512497,512666..512734,512792..512860)) FT /colour=0 FT /note="3 probable transmembrane helices predicted for FT BPSS0373 by TMHMM2.0 at aa 29-51, 71-93 and 150-172" FT CDS complement(513177..514076) FT /note="Similar to Ralstonia solanacearum probable FT transmembrane protein rsc1953 or rs03527 SWALL:Q8XY10 FT (EMBL:AL646067) (336 aa) fasta scores: E(): 2.9e-71, 66.1% FT id in 298 aa, and to Bacillus subtilis hypothetical FT transport protein YetK SWALL:YETK_BACSU (SWALL:O31540) FT (330 aa) fasta scores: E(): 2.6e-32, 33.55% id in 295 aa" FT /locus_tag="BPSS0374" FT /class="4.1.1" FT /colour=3 FT /product="putative membrane protein" FT misc_feature complement(513210..513593) FT /note="Pfam match to entry PF00892 DUF6, Integral membrane FT protein DUF6 , score 79.0, E-value 6.5e-21" FT /colour=9 FT misc_feature complement(order(513210..513269,513282..513350,513375..513434,513462..513530,513567..513626,513654..513722,513741..513809,513822..513890,513927..513986,513996..514064)) FT /colour=0 FT /note="10 probable transmembrane helices predicted for FT BPSS0374 by TMHMM2.0 at aa 5-27, 31-50, 63-85, 90-112, FT 119-141, 151-170, 183-205, 215-234, 243-265 and 270-289" FT misc_feature complement(513669..514040) FT /note="Pfam match to entry PF00892 DUF6, Integral membrane FT protein DUF6 , score 83.8, E-value 2.3e-22" FT /colour=9 FT misc_feature complement(514011..514076) FT /note="Signal peptide predicted for BPSS0374 by SignalP FT 2.0 HMM (Signal peptide probability 0.898) with cleavage FT site probability 0.420 between residues 22 and 23" FT /colour=3 FT CDS 514366..516348 FT /note="Similar to Alcaligenes eutrophus acetyl-coenzyme A FT synthetase AcoE SWALL:ACSA_ALCEU (SWALL:P31638) (660 aa) FT fasta scores: E(): 0, 79.54% id in 660 aa, and to FT Ralstonia solanacearum probable acetyl-coenzyme A FT synthetase protein rsc1952 or rs03526 SWALL:Q8XY11 FT (EMBL:AL646067) (660 aa) fasta scores: E(): 1.2e-213, FT 79.24% id in 660 aa" FT /product="acetyl-coenzyme A synthetase" FT /EC_number="6.2.1.1" FT /gene="acoE" FT /locus_tag="BPSS0375" FT /class="3.2.10" FT /colour=7 FT misc_feature 514708..516045 FT /note="Pfam match to entry PF00501 AMP-binding, FT AMP-binding enzyme , score 445.6, E-value 2.9e-131" FT /colour=9 FT misc_feature 515164..515199 FT /colour=8 FT /note="PS00455 Putative AMP-binding domain signature." FT CDS 516446..516826 FT /locus_tag="BPSS0376" FT /class="4.1.1" FT /colour=3 FT /note="No significant database matches" FT /product="putative membrane protein" FT misc_feature order(516548..516616,516659..516727) FT /colour=0 FT /note="2 probable transmembrane helices predicted for FT BPSS0376 by TMHMM2.0 at aa 35-57 and 72-94" FT CDS 516820..518835 FT /note="Similar to Ralstonia solanacearum probable FT solute:Na+ symporter permease transmembrane protein FT rsc1951 or rs03525 SWALL:Q8XY12 (EMBL:AL646067) (688 aa) FT fasta scores: E(): 2.8e-156, 62.25% id in 673 aa, and to FT Alcaligenes eutrophus hypothetical protein in acoE FT 3'region SWALL:YACO_ALCEU (SWALL:P31640) (332 aa) fasta FT scores: E(): 1e-66, 59.31% id in 322 aa" FT /locus_tag="BPSS0377" FT /class="1.5.2" FT /colour=3 FT /product="putative transport related membrane protein" FT misc_feature order(516838..516891,516919..516987,517048..517116,517129..517197,517255..517323,517351..517419,517456..517524,517915..517983,518017..518085,518296..518364,518425..518481,518509..518577,518596..518664,518707..518775) FT /colour=0 FT /note="14 probable transmembrane helices predicted for FT BPSS0377 by TMHMM2.0 at aa 7-24, 34-56, 77-99, 104-126, FT 146-168, 178-200, 213-235, 366-388, 400-422, 493-515, FT 536-554, 564-586, 593-615 and 630-652" FT misc_feature 517009..518622 FT /note="Pfam match to entry PF00474 SSF, Sodium:solute FT symporter family , score 52.6, E-value 5.5e-13" FT /colour=9 FT misc_feature 518566..518628 FT /colour=8 FT /note="PS00457 Sodium:solute symporter family signature FT 2." FT tRNA 518898..518987 FT /note="tRNA Ser anticodon GGA, Cove score 75.69" FT repeat_unit 518974..518994 FT /note="Genomic island repeat" FT misc_feature 518995..538104 FT /note="Genomic island GI 13" FT CDS 519142..520371 FT /note="Similar to Escherichia coli prophage CP4-57 FT integrase IntA or SlpA or IntX or b2622 SWALL:INTA_ECOLI FT (SWALL:P32053) (413 aa) fasta scores: E(): 2.6e-30, 31.07% FT id in 399 aa, and to Ralstonia solanacearum putative FT integrase prophage protein rsc1896 or rs03460 SWALL:Q8XY67 FT (EMBL:AL646067) (411 aa) fasta scores: E(): 2.3e-67, FT 49.59% id in 373 aa" FT /locus_tag="BPSS0378" FT /class="5.1.2" FT /colour=12 FT /product="putative phage integrase" FT misc_feature 519157..526273 FT /note="Region with similarity of part of (BPSL0081 to FT BPSL0086) Genomic island GI 1" FT misc_feature 519793..520299 FT /note="Pfam match to entry PF00589 Phage_integrase, Phage FT integrase family , score 27.3, E-value 1.5e-06" FT /colour=9 FT CDS 520625..520948 FT /locus_tag="BPSS0379" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT repeat_unit 520964..521346 FT /note="Imperfect repeat, similar to region containing FT BPSS0381" FT CDS 521079..521324 FT /note="Similar to Bacillus subtilis BglII control element FT BglIIC SWALL:Q45487 (EMBL:U49842) (77 aa) fasta scores: FT E(): 3e-06, 40.98% id in 61 aa, and to Salmonella FT enterica, and Salmonella paratyphi-A regulatory protein FT SbaIC SWALL:Q9EZ27 (EMBL:AF508974) (78 aa) fasta scores: FT E(): 4.9e-06, 44.44% id in 72 aa. Note: Also similar to FT BPSS0381 (82 aa) fasta scores: E(): 2.7e-27, 88.889% FT identity in 81 aa overlap" FT /locus_tag="BPSS0380" FT /class="2.2.3" FT /colour=2 FT /product="putative DNA-binding regulatory protein" FT misc_feature 521139..521303 FT /note="Pfam match to entry PF01381 HTH_3, Helix-turn-helix FT , score 41.3, E-value 1.5e-09" FT /colour=9 FT misc_feature 521166..521231 FT /note="Predicted helix-turn-helix motif with score FT 1113.000, SD 2.98 at aa 30-51, sequence FT MSQEALADFAEIDRSHMGKIER" FT /colour=2 FT CDS complement(521382..521678) FT /locus_tag="BPSS0380A" FT /class="0.0.0" FT /colour=8 FT /note="Doubtful CDS. No significant database matches" FT /product="hypothetical protein" FT CDS complement(521774..522100) FT /locus_tag="BPSS0380B" FT /class="0.0.0" FT /colour=8 FT /note="Doubtful CDS. No significant database matches" FT /product="hypothetical protein" FT repeat_region 522360..522742 FT /note="Imperfect repeat, similar to region containing FT BPSS0380" FT CDS 522475..522720 FT /note="Similar to Bacillus subtilis BglII control element FT BglIIC SWALL:Q45487 (EMBL:U49842) (77 aa) fasta scores: FT E(): 1.2e-05, 37.7% id in 61 aa, and to Salmonella FT enterica, and Salmonella paratyphi-a regulatory protein FT SbaIC SWALL:Q9EZ27 (EMBL:AF508974) (78 aa) fasta scores: FT E(): 1.2e-05, 38.88% id in 72 aa. Note: Also similar to FT BPSS0380 (82 aa) fasta scores: E(): 6.3e-28, 88.889% FT identity in 81 aa overlap" FT /locus_tag="BPSS0381" FT /class="2.2.3" FT /colour=2 FT /product="putative DNA-binding regulatory protein" FT misc_feature 522535..522699 FT /note="Pfam match to entry PF01381 HTH_3, Helix-turn-helix FT , score 45.8, E-value 6.3e-11" FT /colour=9 FT misc_feature 522562..522627 FT /note="Predicted helix-turn-helix motif with score FT 1158.000, SD 3.13 at aa 30-51, sequence FT MSQEVLADFVEIDRSHLGKIER" FT /colour=2 FT CDS complement(522852..525719) FT /note="Similar in its N-terminal region to Escherichia FT coli DNA primase TraC SWALL:TRC4_ECOLI (SWALL:P27189) FT (1061 aa) fasta scores: E(): 5.5e-22, 32.87% id in 362 aa, FT and in its C-terminal region to Salmonella typhimurium FT putative inner membrane protein stm2745 SWALL:Q8ZMQ9 FT (EMBL:AE008824) (689 aa) fasta scores: E(): 2.7e-61, FT 33.57% id in 691 aa. Note: Also similar to BPSL0082 (956 FT aa) fasta scores: E(): 0, 91.832% identity in 955 aa FT overlap" FT /locus_tag="BPSS0382" FT /class="0.0.0" FT /colour=8 FT /product="hypothetical protein" FT misc_feature complement(524007..524030) FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT CDS complement(526300..526518) FT /note="Similar to Yersinia pestis putative regulatory FT protein ypo0878 or y3260 SWALL:Q8ZHL3 (EMBL:AJ414145) (66 FT aa) fasta scores: E(): 8.5e-05, 42% id in 50 aa, and to FT Vibrio cholerae transcriptional regulator vc1785 FT SWALL:Q9KR58 (EMBL:AE004255) (68 aa) fasta scores: E(): FT 8.8e-05, 37.03% id in 54 aa" FT /locus_tag="BPSS0383" FT /class="7.0.0" FT /colour=13 FT /product="putative DNA-binding protein" FT misc_feature complement(526408..526473) FT /note="Predicted helix-turn-helix motif with score FT 1189.000, SD 3.24 at aa 16-37, sequence FT VRMPALLERVGLSESEVRRRIK" FT /colour=2 FT CDS complement(526611..527657) FT /locus_tag="BPSS0384" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS complement(527939..528640) FT /locus_tag="BPSS0384A" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS 529868..532291 FT /locus_tag="BPSS0385" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT misc_feature 530789..530812 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT CDS 532668..533243 FT /note="Similar to Escherichia coli transposon tn2501 FT resolvase TnpR SWALL:TNR0_ECOLI (SWALL:P05823) (194 aa) FT fasta scores: E(): 6.7e-43, 67.02% id in 188 aa, and to FT Salmonella typhimurium DNA-invertase Hin or stm2772 FT SWALL:HIN_SALTY (SWALL:P03013) (190 aa) fasta scores: E(): FT 4.3e-17, 37.7% id in 183 aa" FT /product="transposon Tn2501 resolvase" FT /gene="tnpR" FT /locus_tag="BPSS0386" FT /class="5.1.4" FT /colour=12 FT misc_feature 532671..533102 FT /note="Pfam match to entry PF00239 resolvase, Resolvase, N FT terminal domain , score 198.5, E-value 6.8e-57" FT /colour=9 FT misc_feature 532854..532892 FT /colour=8 FT /note="PS00398 Site-specific recombinases signature 2." FT misc_feature 533106..533240 FT /note="Pfam match to entry PF02796 HTH_7, Helix-turn-helix FT domain of resolvase , score 30.9, E-value 1.9e-06" FT /colour=9 FT misc_feature 533169..533234 FT /note="Predicted helix-turn-helix motif with score FT 975.000, SD 2.51 at aa 209-230, sequence FT ASVASLAKFYGTSRQTIMRVRD" FT /colour=2 FT CDS complement(533314..534429) FT /note="Similar to Burkholderia thailandensis bacteriophage FT phiE125 protein Gp31 SWALL:Q8VP95 (EMBL:AY063741) (363 aa) FT fasta scores: E(): 2.3e-32, 36.74% id in 362 aa" FT /locus_tag="BPSS0387" FT /class="5.1.2" FT /colour=12 FT /product="putative phage-related protein" FT CDS complement(534439..535173) FT /note="Similar to Burkholderia thailandensis bacteriophage FT phiE125 protein Gp30 SWALL:Q8VP96 (EMBL:AY063741) (244 aa) FT fasta scores: E(): 7.1e-27, 42.04% id in 245 aa" FT /locus_tag="BPSS0388" FT /class="5.1.2" FT /colour=12 FT /product="putative phage-related protein" FT CDS complement(535170..535697) FT /note="Similar to Burkholderia thailandensis bacteriophage FT phiE125 protein Gp29 SWALL:Q8VP97 (EMBL:AY063741) (186 aa) FT fasta scores: E(): 4.1e-35, 60.77% id in 181 aa" FT /locus_tag="BPSS0389" FT /class="5.1.2" FT /colour=12 FT /product="putative phage-related protein" FT CDS 535977..536156 FT /note="Similar to Rhizobium meliloti hypothetical protein FT r02039 or smc04441 SWALL:Q92K60 (EMBL:AL591789) (62 aa) FT fasta scores: E(): 1.9e-11, 61.01% id in 59 aa, and to FT Clostridium perfringens hypothetical protein pcp27 FT SWALL:Q93MC0 (EMBL:AP003515) (65 aa) fasta scores: E(): FT 6.2e-11, 53.44% id in 58 aa" FT /locus_tag="BPSS0390" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS 536201..536617 FT /note="Similar to Bacteriophage HP1 hypothetical 14.9 kDa FT protein in rep-hol intergenic region SWALL:YO14_BPHP1 FT (SWALL:P51716) (133 aa) fasta scores: E(): 8.8e-14, 38.34% FT id in 133 aa, and to Rhizobium loti hypothetical protein FT mlr2150 SWALL:Q98J17 (EMBL:AP002999) (133 aa) fasta FT scores: E(): 2.2e-11, 40.32% id in 124 aa" FT /locus_tag="BPSS0391" FT /class="5.1.2" FT /colour=12 FT /product="putative phage-related hypothetical protein" FT misc_feature 536201..536389 FT /note="Pfam match to entry PF03681 UPF0150, FT Uncharacterised protein family (UPF0150) , score 52.0, FT E-value 8.4e-13" FT /colour=9 FT CDS complement(537046..537543) FT /locus_tag="BPSS0391A" FT /note="No significant database matches" FT /product="hypothetical protein" FT /class="0.0.0" FT /colour=8 FT repeat_unit 538105..538125 FT /note="Genomic island repeat, 3-prime tRNA Ser fragment" FT misc_feature 538126..549980 FT /note="Low G+C region, possible genomic island region" FT repeat_unit complement(538155..538565) FT /colour=0 FT /note="PF0872" FT CDS complement(538161..538538) FT /note="Gene remnant. Similar to the C-terminal region of FT Escherichia coli ORF5 protein or l7094 SWALL:O53006 FT (EMBL:Y07545) (225 aa) fasta scores: E(): 1.5e-19, 51.78% FT id in 112 aa, and of Providencia rettgeri putative FT transposase Tnp391A SWALL:Q8RL20 (EMBL:AY090559) (225 aa) FT fasta scores: E(): 2.4e-19, 51.78% id in 112 aa" FT /product="IS element hypothetical protein (fragment)" FT /locus_tag="BPSS0392" FT /class="5.1.4" FT /colour=11 FT /pseudo FT misc_feature complement(538200..538538) FT /note="Pfam match to entry PF00665 rve, Integrase core FT domain , score 88.5, E-value 1.7e-25" FT /colour=9 FT CDS complement(538558..538797) FT /note="Gene remnant. Similar to the N-terminal region of FT Bacteriophage phiE125 Gp70 SWALL:Q8W6N0 (EMBL:AF447491) FT (118 aa) fasta scores: E(): 1.5e-30, 89.87% id in 79 aa, FT and of bacteriophage SFV hypothetical 13.1 kDa protein FT ORF53 SWALL:Q8SBD7 (EMBL:U82619) (116 aa) fasta scores: FT E(): 4e-12, 49.33% id in 75 aa" FT /locus_tag="BPSS0393" FT /class="5.1.4" FT /colour=11 FT /product="putative bacteriophage-related protein FT (fragment)" FT /pseudo FT misc_feature complement(538729..538752) FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT CDS complement(539214..539498) FT /note="C-terminus is similar to the C-terminal region of FT Rhizobium meliloti hypothetical protein r00618 or smc04432 FT SWALL:Q92KN5 (EMBL:AL591784) (105 aa) fasta scores: E(): FT 6.9e-07, 52.63% id in 57 aa. Similar to Yersinia pestis FT hypothetical protein ypo1882 or y2427 SWALL:Q8ZF36 FT (EMBL:AJ414150) (96 aa) fasta scores: E(): 1e-06, 41.57% FT id in 89 aa" FT /locus_tag="BPSS0394" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT misc_feature complement(539397..539498) FT /colour=8 FT /note="PS00430 TonB-dependent receptor proteins signature FT 1." FT CDS complement(539482..539703) FT /note="Low similarity in its C-termianl region to Xylella FT fastidiosa hypothetical protein xf1562 SWALL:Q9PD18 FT (EMBL:AE003986) (88 aa) fasta scores: E(): 7.9e-07, 52.94% FT id in 51 aa" FT /locus_tag="BPSS0395" FT /class="0.0.0" FT /colour=8 FT /product="hypothetical protein" FT CDS 540323..540598 FT /note="Similar to Bacteriophage phiE125 Gp49 SWALL:Q8W6Q1 FT (EMBL:AF447491) (91 aa) fasta scores: E(): 3.7e-34, 95.6% FT id in 91 aa" FT /product="bacteriophage protein Gp49" FT /locus_tag="BPSS0396" FT /class="5.1.2" FT /colour=12 FT CDS 540608..540739 FT /note="Similar to Bacteriophage phiE125 Gp48 SWALL:Q8W6Q2 FT (EMBL:AF447491) (43 aa) fasta scores: E(): 1.5e-15, 97.67% FT id in 43 aa" FT /product="bacteriophage protein Gp48" FT /locus_tag="BPSS0397" FT /class="5.1.2" FT /colour=12 FT CDS 540741..540848 FT /locus_tag="BPSS0397A" FT /note="No significant database matches" FT /product="hypothetical protein" FT /class="0.0.0" FT /colour=8 FT CDS 540875..541096 FT /locus_tag="BPSS0398" FT /note="No significant database matches" FT /product="hypothetical protein" FT /class="0.0.0" FT /colour=8 FT CDS complement(541081..541347) FT /note="Similar to Bacteriophage phiE125 Gp46 SWALL:Q8W6Q4 FT (EMBL:AF447491) (84 aa) fasta scores: E(): 2.9e-34, 95.23% FT id in 84 aa" FT /product="bacteriophage protein Gp46" FT /locus_tag="BPSS0399" FT /class="5.1.2" FT /colour=12 FT CDS complement(541537..542235) FT /note="Low similarity in parts to Bacteriophage phiE125 FT Gp45 SWALL:Q8W6Q5 (EMBL:AF447491) (217 aa) fasta scores: FT E(): 0.12, 34.78% id in 115 aa" FT /locus_tag="BPSS0400" FT /class="5.1.2" FT /colour=12 FT /product="putative bacteriophage protein" FT misc_feature complement(order(541957..542016,542044..542100)) FT /colour=0 FT /note="2 probable transmembrane helices predicted for FT BPSS0400 by TMHMM2.0 at aa 46-64 and 74-93" FT CDS 542377..542526 FT /note="Identical to Bacteriophage phiE125 Gp44 FT SWALL:Q8W6Q6 (EMBL:AF447491) (49 aa) fasta scores: E(): FT 8.1e-19, 100% id in 49 aa" FT /product="bacteriophage protein Gp44" FT /locus_tag="BPSS0401" FT /class="5.1.2" FT /colour=12 FT misc_feature 542434..542502 FT /colour=0 FT /note="1 probable transmembrane helix predicted for FT BPSS0401 by TMHMM2.0 at aa 20-42" FT CDS 542523..543698 FT /note="Probable fusion protein. N-terminal region highly FT similar to Bacteriophage phiE125 Gp43 SWALL:Q8W6Q7 FT (EMBL:AF447491) (270 aa) fasta scores: E(): 5e-90, 99.61% FT id in 258 aa, and C-terminal region to Pseudomonas putida FT transposase, ORFB pp4420 SWALL:AAN69997 (EMBL:AE016790) FT (269 aa) fasta scores: E(): 1.3e-18, 48.07% id in 156 aa" FT /product="bacteriophage/transposase fusion protein" FT /locus_tag="BPSS0402" FT /class="5.1.0" FT /colour=12 FT misc_feature 542523..542579 FT /note="Signal peptide predicted for BPSS0402 by SignalP FT 2.0 HMM (Signal peptide probability 0.996) with cleavage FT site probability 0.687 between residues 19 and 20" FT /colour=3 FT misc_feature 542577..543206 FT /note="Pfam match to entry PF01145 Band_7, SPFH domain / FT Band 7 family , score -4.4, E-value 0.0002" FT /colour=9 FT misc_feature 543234..543665 FT /note="Pfam match to entry PF00665 rve, Integrase core FT domain , score 82.7, E-value 4.8e-22" FT /colour=9 FT repeat_unit 543293..543661 FT /note="PF0872" FT /colour=0 FT CDS 543697..544086 FT /note="Probable gene remnant. Similar to the C-terminal FT region of Coxiella burnetii transposase for insertion FT sequence element IS1111a SWALL:TRA1_COXBU (SWALL:Q45968) FT (339 aa) fasta scores: E(): 4.9e-23, 54.54% id in 132 aa, FT and to Edwardsiella ictaluri RmpB-like protein FT SWALL:Q6GUC9 (EMBL:AY641982) (358 aa) fasta scores: E(): FT 7.4e-29, 59.39% id in 133 aa" FT /product="transposase (fragment)" FT /colour=11 FT /locus_tag="BPSS0402A" FT /class="5.1.4" FT /pseudo FT CDS complement(544316..544432) FT /note="Probable gene remnant. Similar to the N-terminal FT regions of Ralstonia solanacearum ISRso16-transposase OrfA FT protein tisrso16A SWALL:Q8XSC1 (EMBL:AL646079) (88 aa) FT fasta scores: E(): 6.6e-08, 79.48% id in 39 aa, and to FT Xanthomonas campestris putative truncated transposase Tnp FT SWALL:Q8RJP9 (EMBL:U33548) (88 aa) fasta scores: E(): FT 9.8e-09, 75.61% id in 41 aa" FT /product="transposase (fragment)" FT /locus_tag="BPSS0402B" FT /colour=11 FT /class="5.1.4" FT /pseudo FT CDS 544679..546139 FT /note="Similar to Ralstonia solanacearum hypothetical FT transmembrane protein rsc2492 or rs01104 SWALL:Q8XWI2 FT (EMBL:AL646070) (502 aa) fasta scores: E(): 1.1e-131, FT 66.73% id in 490 aa, and N-terminal region to Wolbachia FT sp. Wri phosphoprotein phosphatase SWALL:Q9RBM2 FT (EMBL:AJ012073) (428 aa) fasta scores: E(): 7.3e-21, FT 29.89% id in 368 aa. Note: Also similar to BPSS1331 (516 FT aa) fasta scores: E(): 1.2e-154, 87.866% identity in 478 FT aa overlap" FT /locus_tag="BPSS0403" FT /class="4.1.0" FT /colour=3 FT /product="putative exported protein" FT misc_feature 544679..544747 FT /note="Signal peptide predicted for BPSS0403 by SignalP FT 2.0 HMM (Signal peptide probability 0.890) with cleavage FT site probability 0.506 between residues 15 and 16" FT /colour=3 FT misc_feature 545099..545842 FT /note="Pfam match to entry PF00149 Metallophos, FT Calcineurin-like phosphoesterase , score 58.6, E-value FT 8.9e-15" FT /colour=9 FT misc_feature 545390..545407 FT /colour=8 FT /note="PS00125 Serine/threonine specific protein FT phosphatases signature." FT CDS 546190..547560 FT /note="Similar to Paracoccus denitrificans methylamine FT utilization protein precursor MauG SWALL:MAUG_PARDE FT (SWALL:Q51658) (387 aa) fasta scores: E(): 4.3e-18, 34.41% FT id in 369 aa, and to Rhizobium loti methylamine FT utilization protein mlr1826 SWALL:Q98JQ7 (EMBL:AP002998) FT (437 aa) fasta scores: E(): 1.8e-46, 40.57% id in 419 aa. FT Possible alternative translational start site" FT /locus_tag="BPSS0404" FT /class="3.2.6" FT /colour=7 FT /product="putative methylamine utilization protein" FT misc_feature 546319..546957 FT /note="Pfam match to entry PF03150 CCP_MauG, Di-haem FT cytochrome c peroxidase , score 37.0, E-value 4.1e-13" FT /colour=9 FT misc_feature 546475..546492 FT /colour=8 FT /note="PS00190 Cytochrome c family heme-binding site FT signature." FT misc_feature 547012..547029 FT /colour=8 FT /note="PS00190 Cytochrome c family heme-binding site FT signature." FT CDS 547717..548649 FT /note="Similar to Mycobacterium tuberculosis hypothetical FT protein precursor rv2277c or mt2337 or mtcy339.33 FT SWALL:YM77_MYCTU (SWALL:Q50687) (301 aa) fasta scores: FT E(): 2.3e-38, 40.53% id in 301 aa, and to Yersinia pestis FT putative exported protein ypo3232 or y0958 SWALL:Q8ZBZ8 FT (EMBL:AJ414156) (315 aa) fasta scores: E(): 5.7e-29, FT 49.16% id in 299 aa" FT /locus_tag="BPSS0405" FT /class="4.1.0" FT /colour=3 FT /product="glycerophosphoryl diester phosphodiesterase FT family protein" FT misc_feature 547762..547818 FT /note="Signal peptide predicted for BPSS0405 by SignalP FT 2.0 HMM (Signal peptide probability 0.958) with cleavage FT site probability 0.937 between residues 19 and 20" FT /colour=3 FT misc_feature 547846..548619 FT /note="Pfam match to entry PF03009 GDPD, Glycerophosphoryl FT diester phosphodiesterase family , score 76.4, E-value FT 4e-20" FT /colour=9 FT CDS 548847..549050 FT /locus_tag="BPSS0406" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches. Doubtful CDS" FT /product="hypothetical protein" FT CDS 549075..549788 FT /note="Similar to Rhodobacter capsulatus putative FT insertion element SWALL:O68064 (EMBL:AF010496) (191 aa) FT fasta scores: E(): 4e-49, 68.68% id in 182 aa, and to FT Ralstonia solanacearum ISrso14-transposase ORFB protein FT SWALL:Q8XF72 (EMBL:AL646083) (275 aa) fasta scores: E(): FT 1.7e-11, 34.18% id in 234 aa. Note: Also similar in its FT N-terminal region to BPSS0661 (276 aa) fasta scores: E(): FT 5.1e-52, 97.143% identity in 140 aa overlap and in its FT C-terminal region to BPSS0662 (59 aa) fasta scores: E(): FT 3.6e-18, 96.429% identity in 56 aa overlap" FT /product="insertion element hypothetical protein" FT /locus_tag="BPSS0407" FT /class="5.1.4" FT /colour=12 FT repeat_unit 549116..549811 FT /note="PF0872b" FT /colour=0 FT misc_feature 549141..549206 FT /note="Predicted helix-turn-helix motif with score FT 1565.000, SD 4.52 at aa 23-44, sequence FT FGYRTLAHLLGFNKNTVQRIFR" FT /colour=2 FT misc_feature 549273..549770 FT /note="Pfam match to entry PF00665 rve, Integrase core FT domain , score 156.6, E-value 2.9e-44" FT /colour=9 FT misc_feature 549774..549785 FT /colour=8 FT /note="PS00294 Prenyl group binding site (CAAX box)." FT CDS complement(549815..550549) FT /locus_tag="BPSS0408" FT /class="4.1.0" FT /colour=3 FT /note="No significant database matches" FT /product="putative exported protein" FT misc_feature complement(550451..550549) FT /note="Signal peptide predicted for BPSS0408 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.880 between residues 33 and 34" FT /colour=3 FT CDS complement(550540..562935) FT /locus_tag="BPSS0409" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT misc_feature complement(554734..554793) FT /note="Pfam match to entry PF01476 LysM, LysM domain , FT score 2.6, E-value 2.9" FT /colour=9 FT misc_feature complement(554830..554952) FT /note="Pfam match to entry PF01476 LysM, LysM domain , FT score 2.4, E-value 0.32" FT /colour=9 FT misc_feature complement(556309..556443) FT /note="Pfam match to entry PF01476 LysM, LysM domain , FT score 11.2, E-value 0.042" FT /colour=9 FT misc_feature complement(556453..556587) FT /note="Pfam match to entry PF01476 LysM, LysM domain , FT score 27.8, E-value 1.6e-05" FT /colour=9 FT misc_feature complement(556747..556881) FT /note="Pfam match to entry PF01476 LysM, LysM domain , FT score 1.6, E-value 0.38" FT /colour=9 FT misc_feature complement(556894..557028) FT /note="Pfam match to entry PF01476 LysM, LysM domain , FT score 8.2, E-value 0.084" FT /colour=9 FT CDS complement(562919..566497) FT /locus_tag="BPSS0410" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS complement(566615..567391) FT /locus_tag="BPSS0411" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS complement(567424..567849) FT /locus_tag="BPSS0412" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS 568385..568792 FT /locus_tag="BPSS0413" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT misc_feature 569025..569567 FT /note="Pfam match to entry PF02776 TPP_enzymes_N, Thiamine FT pyrophosphate enzyme, N-terminal TPP binding domain , FT score 185.7, E-value 4.8e-53" FT /colour=9 FT CDS 569031..570743 FT /note="Similar to Caulobacter crescentus acetolactate FT synthase, large subunit cc2100 SWALL:Q9A6J3 FT (EMBL:AE005883) (582 aa) fasta scores: E(): 3.3e-53, FT 36.34% id in 575 aa, and to Bacillus subtilis acetolactate FT synthase large subunit IlvB SWALL:ILVB_BACSU FT (SWALL:P37251) (573 aa) fasta scores: E(): 7.6e-53, 33.74% FT id in 572 aa" FT /locus_tag="BPSS0414" FT /class="3.3.20" FT /colour=7 FT /product="putative acetolactate synthase" FT misc_feature 569619..570092 FT /note="Pfam match to entry PF00205 TPP_enzymes, Thiamine FT pyrophosphate enzyme, central domain , score 78.0, E-value FT 1.2e-20" FT /colour=9 FT misc_feature 570129..570662 FT /note="Pfam match to entry PF02775 TPP_enzymes_C, Thiamine FT pyrophosphate enzyme, C-terminal TPP binding domain , FT score 158.4, E-value 7.9e-45" FT /colour=9 FT CDS complement(570903..573890) FT /note="Similar to Salmonella typhimurium putative outer FT membrane lipoprotein YjbH or stm4225 SWALL:Q8ZKI1 FT (EMBL:AE008897) (698 aa) fasta scores: E(): 2.6e-34, FT 40.08% id in 726 aa, and to Escherichia coli hypothetical FT lipoprotein precursor YmcA or b0984 SWALL:YMCA_ECOLI FT (SWALL:P75882) (698 aa) fasta scores: E(): 4.8e-33, 39.68% FT id in 693 aa. Note: N-terminal region presents no FT similarities to any database entries" FT /locus_tag="BPSS0415" FT /class="4.1.0" FT /colour=3 FT /product="putative lipoprotein" FT misc_feature complement(573798..573890) FT /note="Signal peptide predicted for BPSS0415 by SignalP FT 2.0 HMM (Signal peptide probability 0.887) with cleavage FT site probability 0.492 between residues 31 and 32" FT /colour=3 FT misc_feature complement(573822..573854) FT /colour=8 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site." FT CDS complement(573892..574536) FT /locus_tag="BPSS0416" FT /class="4.1.0" FT /colour=3 FT /note="No significant database matches" FT /product="putative lipoprotein" FT misc_feature complement(574462..574536) FT /note="Signal peptide predicted for BPSS0416 by SignalP FT 2.0 HMM (Signal peptide probability 0.990) with cleavage FT site probability 0.817 between residues 25 and 26" FT /colour=3 FT misc_feature complement(574486..574518) FT /colour=8 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site." FT CDS 574629..574985 FT /locus_tag="BPSS0416A" FT /note="No significant database matches" FT /product="hypothetical protein" FT /class="0.0.0" FT /colour=8 FT CDS 575855..578407 FT /note="C-terminus is weakly similar to the C-terinal FT region of Escherichia coli polysialic acid transport FT protein precursor KpsD SWALL:KSD1_ECOLI (SWALL:Q03961) FT (558 aa) fasta scores: E(): 1.4e-09, 25.1% id in 458 aa, FT and to Shewanella oneidensis polysaccharide biosynthesis FT protein so3193 SWALL:AAN56193 (EMBL:AE015757) (921 aa) FT fasta scores: E(): 5.3e-26, 26.41% id in 863 aa" FT /locus_tag="BPSS0417" FT /class="0.0.0" FT /colour=8 FT /product="hypothetical protein" FT CDS 578412..579629 FT /note="Similar to Escherichia coli, and Escherichia coli FT O6 capsule polysaccharide export inner-membrane protein FT KpsE or c3687 SWALL:KSE5_ECOLI (SWALL:P42214) (382 aa) FT fasta scores: E(): 0.00055, 22.35% id in 340 aa, and to FT Ralstonia solanacearum putative tyrosine-protein kinase FT EpsB SWALL:EPB2_RALSO (SWALL:Q45409) (750 aa) fasta FT scores: E(): 7.4e-06, 25.16% id in 302 aa. Note: The FT N-terminal region does not seem to present any FT similarities with database entries. Possible alternative FT translational start site" FT /locus_tag="BPSS0418" FT /class="1.5.5" FT /colour=3 FT /product="putative transport-related membrane protein" FT misc_feature 578496..578939 FT /note="Pfam match to entry PF02706 wzz, Chain length FT determinant protein , score 40.0, E-value 3.4e-09" FT /colour=9 FT misc_feature order(578529..578597,579468..579536) FT /colour=0 FT /note="2 probable transmembrane helices predicted for FT BPSS0418 by TMHMM2.0 at aa 12-34 and 325-347" FT CDS 579626..580402 FT /note="Similar to Salmonella typhimurium FT glucose-1-phosphate cytidylyltransferase RfbF or stm2092 FT SWALL:RFBF_SALTY (SWALL:P26396) (257 aa) fasta scores: FT E(): 4e-73, 68.09% id in 257 aa, and to Yersinia FT enterocolitica DdhA SWALL:Q56860 (EMBL:U46859) (261 aa) FT fasta scores: E(): 9e-74, 66.14% id in 257 aa" FT /product="glucose-1-phosphate cytidylyltransferase FT (O-antigen-related)" FT /EC_number="2.7.7.33" FT /gene="rfbF" FT /locus_tag="BPSS0419" FT /class="2.2.5" FT /colour=0 FT misc_feature 579629..580345 FT /note="Pfam match to entry PF00483 NTP_transferase, FT Nucleotidyl transferase , score 15.5, E-value 2.5e-09" FT /colour=9 FT CDS 580405..581478 FT /note="Similar to Salmonella typhimurium CDP-glucose FT 4,6-dehydratase RfbG or stm2091 SWALL:RFBG_SALTY FT (SWALL:P26397) (359 aa) fasta scores: E(): 2.3e-85, 55.55% FT id in 351 aa, and to Yersinia pseudotuberculosis FT CDP-D-glucose-4,6-dehydratase AscB or DdhB SWALL:Q57329 FT (EMBL:L33181) (357 aa) fasta scores: E(): 8.7e-88, 58.33% FT id in 348 aa" FT /product="CDP-glucose 4,6-dehydratase (O-antigen-related)" FT /EC_number="4.2.1.45" FT /gene="rfbG" FT /locus_tag="BPSS0420" FT /class="2.2.5" FT /colour=0 FT misc_feature 580444..581406 FT /note="Pfam match to entry PF01370 Epimerase, NAD FT dependent epimerase/dehydratase family , score 4.3, FT E-value 1.1e-13" FT /colour=9 FT CDS 581486..582838 FT /note="Similar to Salmonella typhimurium FT lipopolysaccharide biosynthesis protein RfbH or stm2090 FT SWALL:RFBH_SALTY (SWALL:P26398) (437 aa) fasta scores: FT E(): 4.6e-120, 64.45% id in 436 aa, and to Yersinia FT pseudotuberculosis, and Yersinia pseudotuberculosis FT CDP-4-keto-6-deoxy-D-glucose-3-dehydrase DdhC SWALL:Q05341 FT (EMBL:AF461770) (437 aa) fasta scores: E(): 1.3e-119, FT 65.13% id in 436 aa" FT /product="lipopolysaccharide biosynthesis protein FT (O-antigen-related)" FT /gene="rfbH" FT /locus_tag="BPSS0421" FT /class="2.2.5" FT /colour=0 FT misc_feature 581642..582814 FT /note="Pfam match to entry PF01041 DegT_DnrJ_EryC1, FT DegT/DnrJ/EryC1/StrS aminotransferase family , score FT 490.0, E-value 1.2e-144" FT /colour=9 FT CDS 582864..584624 FT /note="C-terminal region similar to Escherichia coli, and FT Escherichia coli O157:H7 perosamine synthetase Per or RfbE FT or z3200 or ecs2841 SWALL:O07849 (EMBL:AF061251) (366 aa) FT fasta scores: E(): 3.5e-50, 38.76% id in 356 aa and FT N-terminal region similar to Agrobacterium tumefaciens FT acetyltransferase atu2080 or agr_c_3768 SWALL:Q8UDP1 FT (EMBL:Q8UDP1) (177 aa) blastp scores: Score = 39.9 bits FT (91), Expect = 0.14 Identities = 46/165 (27%), Positives = FT 70/165 (41%), Gaps = 18/165 (10%)" FT /locus_tag="BPSS0422" FT /class="7.0.0" FT /colour=13 FT /product="putative aminotransferase" FT misc_feature 583143..583391 FT /note="Pfam match to entry PF00583 Acetyltransf, FT Acetyltransferase (GNAT) family , score 41.5, E-value FT 1.3e-09" FT /colour=9 FT misc_feature 583545..584606 FT /note="Pfam match to entry PF01041 DegT_DnrJ_EryC1, FT DegT/DnrJ/EryC1/StrS aminotransferase family , score FT 503.3, E-value 1.2e-148" FT /colour=9 FT CDS 584873..586228 FT /note="Similar to Salmonella enterica hypothetical protein FT with 12 predicted transmembrane segments which possibly FT functions in export of O-antigen SWALL:Q00339 FT (EMBL:X61917) (446 aa) fasta scores: E(): 2e-39, 30.15% id FT in 441 aa, and to Sphingomonas sp. S88 hypothetical 47.3 FT kDa protein SpsS SWALL:P74815 (EMBL:U51197) (452 aa) fasta FT scores: E(): 1.5e-05, 26.01% id in 469 aa" FT /locus_tag="BPSS0423" FT /class="4.1.1" FT /colour=3 FT /product="putative membrane protein" FT misc_feature order(585188..585256,585299..585367,585401..585460,585473..585541,585641..585709,585737..585805,585866..585919,585947..586015,586052..586120,586130..586198) FT /colour=0 FT /note="10 probable transmembrane helices predicted for FT BPSS0423 by TMHMM2.0 at aa 112-134, 149-171, 183-202, FT 207-229, 263-285, 295-317, 338-355, 365-387, 400-422 and FT 426-448" FT CDS 586225..587286 FT /note="Similar to Salmonella enterica WbaR protein FT SWALL:Q00337 (EMBL:X61917) (320 aa) fasta scores: E(): FT 1.1e-15, 32.25% id in 248 aa, and low similarity to FT Salmonella typhimurium O antigen biosynthesis FT abequosyltransferase RfbV or stm2087 SWALL:RFBV_SALTY FT (SWALL:P26401) (333 aa) fasta scores: E(): 0.00069, 26.54% FT id in 275 aa" FT /locus_tag="BPSS0424" FT /class="7.0.0" FT /colour=13 FT /product="putative glycosyl transferase" FT misc_feature 586252..586761 FT /note="Pfam match to entry PF00535 Glycos_transf_2, FT Glycosyl transferase , score 93.9, E-value 2e-25" FT /colour=9 FT CDS 587459..588715 FT /note="Similar to Escherichia coli lipopolysaccharide FT heptosyltransferase-1 RfaC or WaaC or Rfa-2 or b3621 FT SWALL:RFAC_ECOLI (SWALL:P24173) (319 aa) fasta scores: FT E(): 7.8e-07, 26.45% id in 310 aa, and to Rhizobium loti FT ADP-heptose-LPS heptosyltransferase mlr2566 SWALL:Q98I51 FT (EMBL:AP003000) (335 aa) fasta scores: E(): 1.8e-15, FT 26.87% id in 346 aa" FT /locus_tag="BPSS0425" FT /class="2.2.5" FT /colour=0 FT /product="putative heptosyltransferase (O-antigen FT related)" FT misc_feature 587720..588445 FT /note="Pfam match to entry PF01075 Glyco_transf_9, FT Glycosyltransferase family 9 (heptosyltransferase) , score FT 31.4, E-value 1.4e-08" FT /colour=9 FT CDS 588621..589676 FT /note="Similar to Escherichia coli WaaQ SWALL:Q9R9D5 FT (EMBL:AF019746) (340 aa) fasta scores: E(): 4.7e-06, FT 22.68% id in 335 aa, and to Neisseria gonorrhoeae FT ADP-heptose:LPS heptosyltransferase II RfaF SWALL:Q51063 FT (EMBL:Z37141) (336 aa) fasta scores: E(): 5.8e-09, 24.92% FT id in 349 aa" FT /locus_tag="BPSS0426" FT /class="2.2.5" FT /colour=0 FT /product="putative heptosyltransferase (O-antigen FT related)" FT misc_feature 588810..589565 FT /note="Pfam match to entry PF01075 Glyco_transf_9, FT Glycosyltransferase family 9 (heptosyltransferase) , score FT -24.1, E-value 2.2e-05" FT /colour=9 FT CDS 589669..590238 FT /note="Similar to Escherichia coli putative FT lipopolysaccharide biosynthesis O-acetyl transferase WbbJ FT or b2033 SWALL:WBBJ_ECOLI (SWALL:P37750) (196 aa) fasta FT scores: E(): 4.5e-09, 36.06% id in 122 aa, and to FT Aeromonas hydrophila O-acetyl transferase SWALL:AAM74482 FT (EMBL:AF148126) (199 aa) fasta scores: E(): 2.2e-11, 31.6% FT id in 174 aa" FT /locus_tag="BPSS0427" FT /class="2.2.5" FT /colour=0 FT /product="putative O-acetyl transferase FT (O-antigen-related)" FT misc_feature 589882..589935 FT /note="Pfam match to entry PF00132 hexapep, Bacterial FT transferase hexapeptide (four repeats) , score 6.8, FT E-value 6.5" FT /colour=9 FT misc_feature 589942..589995 FT /note="Pfam match to entry PF00132 hexapep, Bacterial FT transferase hexapeptide (four repeats) , score 14.1, FT E-value 0.22" FT /colour=9 FT misc_feature 590071..590124 FT /note="Pfam match to entry PF00132 hexapep, Bacterial FT transferase hexapeptide (four repeats) , score 11.2, FT E-value 1.6" FT /colour=9 FT misc_feature 590125..590178 FT /note="Pfam match to entry PF00132 hexapep, Bacterial FT transferase hexapeptide (four repeats) , score 3.9, FT E-value 15" FT /colour=9 FT CDS 590250..591296 FT /note="Similar to Salmonella enterica rhamnosyl FT transferase SWALL:Q00482 (EMBL:X61917) (347 aa) fasta FT scores: E(): 4.6e-25, 30.03% id in 323 aa, and to FT Salmonella typhimurium O antigen biosynthesis FT abequosyltransferase RfbV or stm2087 SWALL:RFBV_SALTY FT (SWALL:P26401) (333 aa) fasta scores: E(): 0.00046, 23.58% FT id in 229 aa" FT /locus_tag="BPSS0428" FT /class="2.2.5" FT /colour=0 FT /product="putative glycosyl transferase (O-antigen FT related)" FT misc_feature 590265..590795 FT /note="Pfam match to entry PF00535 Glycos_transf_2, FT Glycosyl transferase , score 70.8, E-value 1.9e-18" FT /colour=9 FT misc_feature 591180..591248 FT /colour=0 FT /note="1 probable transmembrane helix predicted for FT BPSS0428 by TMHMM2.0 at aa 311-333" FT CDS 591300..592349 FT /locus_tag="BPSS0429" FT /class="4.1.1" FT /colour=3 FT /note="No significant database matches" FT /product="putative membrane protein" FT misc_feature order(591303..591371,591489..591557,591615..591683,591711..591779,591813..591881,591891..591959,592128..592196,592239..592307) FT /colour=0 FT /note="8 probable transmembrane helices predicted for FT BPSS0429 by TMHMM2.0 at aa 2-24, 64-86, 106-128, 138-160, FT 172-194, 198-220, 277-299 and 314-336" FT CDS complement(join(592791..592973,592978..592992,592992..593036,593038..593187,593199..593306)) FT /note="Pseudogene. Similar to Escherichia coli FT hypothetical 19.6 kDa protein SWALL:Q9L910 (EMBL:AF188737) FT (172 aa) fasta scores: E(): 2.6e-19, 40.36% id in 166 aa, FT and to Shewanella oneidensis conserved hypothetical FT protein so1764 SWALL:AAN54818 (EMBL:AE015620) (171 aa) FT fasta scores: E(): 2.4e-10, 29.69% id in 165 aa. CDS FT contains several frameshift mutations" FT /locus_tag="BPSS0430" FT /class="0.0.2" FT /colour=11 FT /product="conserved hypothetical protein (pseudogene)" FT /pseudo FT CDS complement(593393..594292) FT /note="Similar to Pseudomonas putida transcriptional FT regulator, LysR family pp3811 SWALL:AAN69405 FT (EMBL:AE016788) (294 aa) fasta scores: E(): 9.2e-52, 50% FT id in 288 aa, and to Bradyrhizobium japonicum FT transcriptional regulatory protein blr6553 SWALL:BAC51818 FT (EMBL:AP005959) (323 aa) fasta scores: E(): 8.9e-39, FT 41.69% id in 295 aa" FT /locus_tag="BPSS0431" FT /class="6.3.6" FT /colour=9 FT /product="putative LysR-family transcriptional regulator" FT misc_feature complement(593420..594037) FT /note="Pfam match to entry PF03466 LysR_substrate, LysR FT substrate binding domain , score 193.5, E-value 2.2e-55" FT /colour=9 FT misc_feature complement(594107..594286) FT /note="Pfam match to entry PF00126 HTH_1, Bacterial FT regulatory helix-turn-helix protein, lysR family , score FT 76.1, E-value 4.8e-20" FT /colour=9 FT misc_feature complement(594152..594244) FT /colour=8 FT /note="PS00044 Bacterial regulatory proteins, lysR family FT signature." FT misc_feature complement(594182..594247) FT /note="Predicted helix-turn-helix motif with score FT 1017.000, SD 2.65 at aa 42-63, sequence FT GSFTGAADKLLLSKQFVSRRVM" FT /colour=2 FT CDS 594422..595147 FT /note="Similar to Escherichia coli protein YhhW or b3439 FT SWALL:YHHW_ECOLI (SWALL:P46852) (231 aa) fasta scores: FT E(): 2.7e-42, 49.57% id in 234 aa, and to Xanthomonas FT axonopodis hypothetical protein xac1747 SWALL:AAM36613 FT (EMBL:AE011806) (233 aa) fasta scores: E(): 2.7e-52, FT 58.44% id in 231 aa" FT /locus_tag="BPSS0432" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT misc_feature 594422..595117 FT /note="Pfam match to entry PF02678 DUF209, Uncharacterized FT BCR, YhhW family COG1741 , score 403.1, E-value 1.8e-118" FT /colour=9 FT CDS 595429..596109 FT /note="Highly similar in its N-terminal region to FT Rhizobium loti hypothetical protein mlr1837 SWALL:Q98JQ1 FT (EMBL:AP002998) (143 aa) fasta scores: E(): 2.3e-30, FT 68.08% id in 141 aa, and similar in its full length to FT Ralstonia solanacearum putative permease transmembrane FT protein rsc0238 or rs00670 SWALL:Q8Y2U4 (EMBL:AL646058) FT (236 aa) fasta scores: E(): 6.9e-20, 39.42% id in 208 aa" FT /locus_tag="BPSS0433" FT /class="4.1.1" FT /colour=3 FT /product="putative membrane protein" FT misc_feature order(595447..595515,595558..595626,595663..595731,595759..595818,595948..596016,596026..596079) FT /colour=0 FT /note="6 probable transmembrane helices predicted for FT BPSS0433 by TMHMM2.0 at aa 7-29, 44-66, 79-101, 111-130, FT 174-196 and 200-217" FT CDS complement(596139..597170) FT /note="Low similarity to Xanthomonas axonopodis FT thioredoxin reductase TrxB or xac1182 SWALL:AAM36054 FT (EMBL:AE011747) (365 aa) fasta scores: E(): 9.5e-05, FT 28.67% id in 286 aa" FT /locus_tag="BPSS0434" FT /class="0.0.0" FT /colour=8 FT /product="hypothetical protein" FT misc_feature complement(596796..597074) FT /note="Pfam match to entry PF00027 cNMP_binding, Cyclic FT nucleotide-binding domain , score 22.0, E-value 0.00093" FT /colour=9 FT CDS 597509..598435 FT /note="C-terminus is similar to the C-terminal regions of FT Rhizobium loti probable transcriptional regulator mll0489 FT SWALL:Q98MP6 (EMBL:AP002995) (313 aa) fasta scores: E(): FT 5.7e-24, 36.29% id in 259 aa, and Pseudomonas aeruginosa FT probable transcriptional regulator pa2696 SWALL:Q9I0E6 FT (EMBL:AE004697) (297 aa) fasta scores: E(): 5.5e-20, FT 34.07% id in 226 aa" FT /locus_tag="BPSS0435" FT /class="6.3.2" FT /colour=9 FT /product="putative AraC-family transcriptional regulator" FT misc_feature 598121..598255 FT /colour=8 FT /note="PS00041 Bacterial regulatory proteins, araC family FT signature." FT misc_feature 598133..598270 FT /note="Pfam match to entry PF00165 HTH_AraC, Bacterial FT regulatory helix-turn-helix proteins, araC family , score FT 54.1, E-value 2e-13" FT /colour=9 FT misc_feature 598169..598234 FT /note="Predicted helix-turn-helix motif with score FT 1416.000, SD 4.01 at aa 221-242, sequence FT VPISQVASACGLSRSYFIKAFR" FT /colour=2 FT misc_feature 598277..598405 FT /colour=8 FT /note="PS00041 Bacterial regulatory proteins, araC family FT signature." FT misc_feature 598289..598420 FT /note="Pfam match to entry PF00165 HTH_AraC, Bacterial FT regulatory helix-turn-helix proteins, araC family , score FT 38.3, E-value 1.1e-08" FT /colour=9 FT CDS complement(598494..599396) FT /note="Similar to Rhizobium leguminosarum putative FT arac-like transcriptional regulator SWALL:Q93EA6 FT (EMBL:AF361470) (303 aa) fasta scores: E(): 1.6e-38, FT 38.92% id in 298 aa, and to Rhizobium leguminosarum FT putative arac-like transcriptional regulator SWALL:Q93EA7 FT (EMBL:AF361470) (306 aa) fasta scores: E(): 3.7e-14, FT 26.88% id in 305 aa" FT /locus_tag="BPSS0436" FT /class="6.3.2" FT /colour=9 FT /product="putative AraC-family regulatory protein" FT misc_feature complement(598509..598640) FT /note="Pfam match to entry PF00165 HTH_AraC, Bacterial FT regulatory helix-turn-helix proteins, araC family , score FT 55.6, E-value 6.8e-14" FT /colour=9 FT misc_feature complement(598524..598652) FT /colour=8 FT /note="PS00041 Bacterial regulatory proteins, araC family FT signature." FT misc_feature complement(598659..598787) FT /note="Pfam match to entry PF00165 HTH_AraC, Bacterial FT regulatory helix-turn-helix proteins, araC family , score FT 38.2, E-value 1.2e-08" FT /colour=9 FT CDS complement(599746..600948) FT /note="Similar to Rhizobium loti hypothetical protein FT mll3464 SWALL:Q98G70 (EMBL:AP003002) (405 aa) fasta FT scores: E(): 1.3e-54, 44.63% id in 401 aa, and to FT Xanthomonas campestris MFS transporter xcc0495 FT SWALL:AAM39811 (EMBL:AE012146) (396 aa) fasta scores: E(): FT 3.3e-42, 39.23% id in 390 aa" FT /locus_tag="BPSS0437" FT /class="4.1.1" FT /colour=3 FT /product="putative transporter protein" FT misc_feature complement(599752..600885) FT /note="Pfam match to entry PF00083 sugar_tr, Sugar (and FT other) transporter , score -109.7, E-value 0.00055" FT /colour=9 FT misc_feature complement(order(599764..599832,599845..599913,599977..600045,600112..600180,600361..600429,600457..600525,600544..600612,600622..600690,600724..600792,600820..600888)) FT /colour=0 FT /note="10 probable transmembrane helices predicted for FT BPSS0437 by TMHMM2.0 at aa 21-43, 53-75, 87-109, 113-135, FT 142-164, 174-196, 257-279, 302-324, 346-368 and 373-395" FT CDS 601354..602265 FT /note="Similar to Ralstonia solanacearum probable FT transcription regulator protein rsp0910 or rs01682 FT SWALL:Q8XRE4 (EMBL:AL646081) (309 aa) fasta scores: E(): FT 5.5e-53, 49.5% id in 303 aa, and to Pseudomonas aeruginosa FT probable transcriptional regulator pa0056 SWALL:Q9I776 FT (EMBL:AE004445) (306 aa) fasta scores: E(): 3.5e-30, FT 35.43% id in 302 aa" FT /locus_tag="BPSS0438" FT /class="6.3.6" FT /colour=9 FT /product="putative LysR-family transcriptional regulator" FT misc_feature 601363..601542 FT /note="Pfam match to entry PF00126 HTH_1, Bacterial FT regulatory helix-turn-helix protein, lysR family , score FT 73.4, E-value 3.1e-19" FT /colour=9 FT misc_feature 601402..601467 FT /note="Predicted helix-turn-helix motif with score FT 1147.000, SD 3.09 at aa 17-38, sequence FT GGFSKAARQLGTATSSVTRLMD" FT /colour=2 FT misc_feature 601405..601497 FT /colour=8 FT /note="PS00044 Bacterial regulatory proteins, lysR family FT signature." FT misc_feature 601612..602247 FT /note="Pfam match to entry PF03466 LysR_substrate, LysR FT substrate binding domain , score 167.3, E-value 1.6e-47" FT /colour=9 FT CDS complement(602395..603081) FT /note="Similar to Ralstonia solanacearum putative FT hydrolase protein rsc0242 or rs00674 SWALL:Q8Y2U0 FT (EMBL:AL646058) (228 aa) fasta scores: E(): 2.4e-77, 85.9% FT id in 227 aa, and to Rhizobium meliloti putative hydrolase FT ra0202 or sma0376 SWALL:Q930J3 (EMBL:AE007213) (229 aa) FT fasta scores: E(): 5.6e-68, 78.94% id in 228 aa" FT /locus_tag="BPSS0439" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT misc_feature complement(602566..603057) FT /note="Pfam match to entry PF00857 Isochorismatase, FT Isochorismatase family , score -12.8, E-value 0.00011" FT /colour=9 FT CDS 603608..603922 FT /note="Similar to Xanthomonas campestris hypothetical FT protein xcc2052 SWALL:Q8P914 (EMBL:AE012311) (102 aa) FT fasta scores: E(): 9.2e-19, 62.13% id in 103 aa, and to FT Rhizobium leguminosarum hypothetical 10.3 kDa protein FT SWALL:Q93EB2 (EMBL:AF361470) (96 aa) fasta scores: E(): FT 7.9e-15, 56.38% id in 94 aa" FT /locus_tag="BPSS0440" FT /class="4.1.1" FT /colour=3 FT /product="putative membrane protein" FT misc_feature join(603608..603652,603695..603754) FT /colour=0 FT /note="2 probable transmembrane helices predicted for FT BPSS0440 by TMHMM2.0 at aa 13-35 and 50-69" FT CDS 603915..605813 FT /note="Similar to Agrobacterium tumefaciens hypothetical FT protein atu3982 or agr_l_1745 SWALL:Q8U8V6 (EMBL:AE009329) FT (625 aa) fasta scores: E(): 1.1e-204, 79.32% id in 624 aa, FT and to Ralstonia solanacearum hypothetical protein rsc0239 FT or rs00671 SWALL:Q8Y2U3 (EMBL:AL646058) (612 aa) fasta FT scores: E(): 7e-154, 65.59% id in 625 aa" FT /locus_tag="BPSS0441" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT misc_feature 605277..605300 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT CDS 605992..607227 FT /note="C-terminal region similar to C-terminal region of FT Xanthomonas campestris hypothetical protein xcc2051 FT SWALL:Q8P915 (EMBL:AE012311) (403 aa) fasta scores: E(): FT 4e-61, 63.57% id in 280 aa, and similar in its C-terminal FT region to the full length of Bradyrhizobium japonicum FT protein blr4261 SWALL:BAC49526 (EMBL:AP005950) (310 aa) FT fasta scores: E(): 1.4e-60, 59.04% id in 293 aa, FT N-terminal region similar to Streptomyces coelicolor FT hypothetical protein sco0467 or scf76.07 SWALL:Q9RJG7 FT (EMBL:Q9RJG7) blastp scores: Score = 49.2 bits (115), FT Expect = 1e-04 Identities = 24/55 (43%), Positives = 34/55 FT (61%), Gaps = 1/55 (1%)" FT /locus_tag="BPSS0442" FT /class="0.0.0" FT /colour=8 FT /product="hypothetical protein" FT misc_feature 606679..606828 FT /note="Pfam match to entry PF00903 Glyoxalase, FT Glyoxalase/Bleomycin resistance protein/Dioxygenase FT superfamily , score 9.9, E-value 0.01" FT /colour=9 FT CDS 607554..608903 FT /note="Similar to Xanthomonas campestris hypothetical FT protein xcc2050 SWALL:AAM41339 (EMBL:AE012311) (463 aa) FT fasta scores: E(): 4.3e-106, 57.7% id in 435 aa, and to FT Zymomonas mobilis hypothetical 54.0 kDa protein FT SWALL:Q9RQC9 (EMBL:AF117351) (483 aa) fasta scores: E(): FT 1.2e-07, 24.41% id in 340 aa" FT /locus_tag="BPSS0443" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS 609469..610290 FT /note="Similar to Pseudomonas fluorescens non-heme FT chloroperoxidase Cpo or CpoF SWALL:PRXC_PSEFL FT (SWALL:O31158) (273 aa) fasta scores: E(): 2.3e-73, 67.77% FT id in 270 aa, and to Burkholderia cepacia chloride FT peroxidase SWALL:Q8VT61 (EMBL:AF335493) (273 aa) fasta FT scores: E(): 1.2e-86, 78.59% id in 271 aa" FT /product="non-heme chloroperoxidase" FT /EC_number="1.11.1.10" FT /gene="cpo" FT /gene="cpoF" FT /locus_tag="BPSS0444" FT /class="1.4.2" FT /colour=0 FT misc_feature 609610..610281 FT /note="Pfam match to entry PF00561 abhydrolase, alpha/beta FT hydrolase fold , score 152.3, E-value 5.6e-43" FT /colour=9 FT CDS join(610317..610337,610340..610729,610737..610859) FT /note="Probable gene remnant. Similar to the C-terminal FT region of Ralstonia solanacearum probable transcription FT regulator protein rsp1110 or rs02618 SWALL:Q8XQV8 FT (EMBL:AL646082) (315 aa) fasta scores: E(): 4.7e-25, FT 46.59% id in 176 aa, and of Burkholderia cepacia putative FT transcriptional regulator CeoR SWALL:Q8VL17 FT (EMBL:AY008288) (334 aa) fasta scores: E(): 7.6e-25, FT 48.53% id in 171 aa. CDS contains frameshift mutations FT after codons 7 and 138. Note, feature lacks a FT translational start codon" FT /locus_tag="BPSS0445" FT /class="6.3.6" FT /colour=11 FT /product="putative LysR-family transcriptional regulator FT (fragment)" FT /pseudo FT misc_feature 610358..610708 FT /note="Pfam match to entry PF03466 LysR_substrate, LysR FT substrate binding domain , score 43.5, E-value 7.8e-12" FT /colour=9 FT misc_feature 610631..610654 FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT CDS 611180..611809 FT /note="Similar to Xanthomonas axonopodis hypothetical FT protein xac0432 SWALL:Q8PQ96 (EMBL:AE011670) (226 aa) FT fasta scores: E(): 1.2e-40, 57.61% id in 210 aa, and to FT Pseudomonas aeruginosa hypothetical protein pa4017 FT SWALL:Q9HX10 (EMBL:AE004818) (213 aa) fasta scores: E(): FT 4.1e-21, 42.1% id in 209 aa" FT /locus_tag="BPSS0446" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT CDS 612507..613112 FT /note="Similar to Escherichia coli hypothetical protein FT YddH or b1462 SWALL:YDDH_ECOLI (SWALL:P76121) (189 aa) FT fasta scores: E(): 2.5e-22, 38.42% id in 190 aa, and to FT Xanthomonas campestris hypothetical protein xcc3203 FT SWALL:AAM42473 (EMBL:AE012437) (193 aa) fasta scores: E(): FT 6.4e-08, 28.49% id in 179 aa" FT /locus_tag="BPSS0447" FT /class="0.0.2" FT /colour=10 FT /product="conserved hypothetical protein" FT misc_feature 612546..612998 FT /note="Pfam match to entry PF01613 Flavin_Reduct, Flavin FT reductase like domain , score 16.5, E-value 1.3e-06" FT /colour=9 FT CDS complement(613249..613701) FT /locus_tag="BPSS0448" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS complement(613963..615297) FT /note="Similar to Rhodobacter sphaeroides hypothetical FT transcriptional regulator in rdxA 3'region FT SWALL:YRDX_RHOSH (SWALL:Q01856) (456 aa) fasta scores: FT E(): 1.1e-45, 37.81% id in 439 aa, and to Pseudomonas FT aeruginosa probable transcriptional regulator pa2100 FT SWALL:Q9I215 (EMBL:AE004637) (477 aa) fasta scores: E(): FT 6.5e-43, 35.46% id in 423 aa" FT /locus_tag="BPSS0449" FT /class="6.3.3" FT /colour=9 FT /product="putative GntR-family regulatory protein" FT misc_feature complement(613981..614880) FT /note="Pfam match to entry PF00155 aminotran_1_2, FT Aminotransferase class I and II , score 24.7, E-value FT 5.1e-08" FT /colour=9 FT misc_feature complement(615094..615273) FT /note="Pfam match to entry PF00392 gntR, Bacterial FT regulatory proteins, gntR family , score 53.0, E-value FT 4.2e-13" FT /colour=9 FT CDS 615386..616003 FT /note="Similar to Methanosarcina mazei transcriptional FT regulator, AraC family mm3310 SWALL:AAM33006 FT (EMBL:AE013592) (209 aa) fasta scores: E(): 6.8e-05, FT 26.92% id in 208 aa, and to parts of Xanthomonas FT campestris thiJ/pfpI family protein xcc3565 SWALL:AAM42835 FT (EMBL:AE012477) (257 aa) fasta scores: E(): 5.9e-07, FT 29.37% id in 177 aa" FT /locus_tag="BPSS0450" FT /class="7.0.0" FT /colour=13 FT /product="DJ-1/PfpI family protein" FT misc_feature 615386..615880 FT /note="Pfam match to entry PF01965 DJ-1_PfpI, DJ-1/PfpI FT family , score 15.5, E-value 6.2e-05" FT /colour=9 FT CDS complement(616361..617449) FT /note="C-terminal region is similar to Escherichia coli, FT and Shigella flexneri penicillin-binding protein 7 FT precursor PbpG or b2134 or sf2219 or s2348 FT SWALL:PBP7_ECOLI (SWALL:P33364) (313 aa) fasta scores: FT E(): 2.9e-36, 46.69% id in 272 aa. Full length CDS is FT similar to Ralstonia solanacearum putative FT D-alanyl-D-alanine-endopeptidase rsc1609 or rs03972 FT SWALL:Q8XYZ7 (EMBL:AL646065) (375 aa) fasta scores: E(): FT 1.2e-51, 47.82% id in 345 aa" FT /product="family S11 unassigned peptidase" FT /locus_tag="BPSS0451" FT /class="4.1.2" FT /colour=3 FT misc_feature complement(616391..617203) FT /note="Pfam match to entry PF00768 Peptidase_S11, FT D-alanyl-D-alanine carboxypeptidase , score 194.4, E-value FT 1.2e-55" FT /colour=9 FT CDS 618584..620524 FT /note="Similar in its N-terminal region to FT Thermoanaerobacter tengcongensis DNA polymerase IV Pol4 or FT tte2516 SWALL:Q8R7A2 (EMBL:AE013193) (570 aa) fasta FT scores: E(): 3.1e-74, 43.36% id in 565 aa, and to Bacillus FT halodurans DNA-dependent DNA polymerase beta chain bh3107 FT SWALL:Q9K899 (EMBL:AP001517) (571 aa) fasta scores: E(): FT 5.3e-63, 38.21% id in 581 aa. Note: This CDS presents no FT similarity to any of the database matches in its FT C-terminal region (from approx. residue 577 onwards)" FT /locus_tag="BPSS0452" FT /class="7.0.0" FT /colour=13 FT /product="putative phosphoesterase" FT misc_feature 619604..619837 FT /note="Pfam match to entry PF02231 PHP_N, PHP domain FT N-terminal region , score 91.6, E-value 1e-24" FT /colour=9 FT misc_feature 619901..620200 FT /note="Pfam match to entry PF02811 PHP_C, PHP domain FT C-terminal region , score 29.4, E-value 5.4e-06" FT /colour=9 FT CDS 620793..621200 FT /locus_tag="BPSS0453" FT /class="4.1.0" FT /colour=3 FT /note="No significant database matches" FT /product="putative exported protein" FT misc_feature 620793..620861 FT /note="Signal peptide predicted for BPSS0453 by SignalP FT 2.0 HMM (Signal peptide probability 0.984) with cleavage FT site probability 0.835 between residues 29 and 30" FT /colour=3 FT CDS 621293..621589 FT /locus_tag="BPSS0454" FT /class="4.1.0" FT /colour=3 FT /note="No significant database matches" FT /product="putative exported protein" FT misc_feature 621293..621370 FT /note="Signal peptide predicted for BPSS0454 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.789 between residues 26 and 27" FT /colour=3 FT CDS 621586..623250 FT /note="Similar to Agrobacterium tumefaciens copper FT tolerance protein CopB or atu3992 or agr_l_1720 FT WALL:Q8U8U6 (EMBL:AE009330) (492 aa) fasta scores: E(): FT 1.1e-42, 40.04% id in 482 aa, and to Rhizobium meliloti FT hypothetical protein ra0562 or sma1037 SWALL:Q92ZC8 FT (EMBL:AE007246) (488 aa) fasta scores: E(): 3.4e-42, FT 39.17% id in 485 aa" FT /locus_tag="BPSS0455" FT /class="1.4.2" FT /colour=0 FT /product="putative copper resistance-related lipoprotein" FT misc_feature 621586..621702 FT /note="Signal peptide predicted for BPSS0455 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.627 between residues 39 and 40" FT /colour=3 FT misc_feature 621622..621654 FT /colour=8 FT /note="PS00013 Prokaryotic membrane lipoprotein lipid FT attachment site." FT misc_feature 621802..622356 FT /note="Pfam match to entry PF02321 OEP, Outer membrane FT efflux protein , score 30.9, E-value 1.9e-06" FT /colour=9 FT misc_feature 622393..622962 FT /note="Pfam match to entry PF02321 OEP, Outer membrane FT efflux protein , score 36.9, E-value 3e-08" FT /colour=9 FT misc_feature 623247..623330 FT /note="Signal peptide predicted for BPSS0456 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.919 between residues 28 and 29" FT /colour=3 FT CDS 623253..624548 FT /note="Similar to Bradyrhizobium japonicum multicopper FT oxidase CopA or bll2210 SWALL:BAC47475 (EMBL:AP005942) FT (445 aa) fasta scores: E(): 5.9e-124, 70.99% id in 424 aa, FT and low to the plasmid-borne Escherichia coli copper FT resistance protein A precursor PcoA SWALL:PCOA_ECOLI FT (SWALL:Q47452) (605 aa) fasta scores: E(): 2e-12, 26.94% FT id in 386 aa" FT /locus_tag="BPSS0456" FT /class="1.4.2" FT /colour=0 FT /product="putative exported copper oxidase" FT misc_feature 623838..624281 FT /note="Pfam match to entry PF00394 Cu-oxidase, Multicopper FT oxidase , score 31.7, E-value 1.1e-06" FT /colour=9 FT misc_feature 624198..624233 FT /colour=8 FT /note="PS00080 Multicopper oxidases signature 2." FT CDS 624667..625023 FT /note="Similar to Ralstonia solanacearum hypothetical FT signal peptide protein rsp0929 or rs05404 SWALL:Q8XRC9 FT (EMBL:AL646081) (114 aa) fasta scores: E(): 2.3e-10, FT 45.76% id in 118 aa, and to Rhizobium meliloti FT hypothetical signal peptide protein r00588 or smc02284 FT SWALL:Q92S41 (EMBL:AL591784) (94 aa) fasta scores: E(): FT 8.3e-08, 52% id in 75 aa" FT /locus_tag="BPSS0457" FT /class="4.1.0" FT /colour=3 FT /product="putative exported protein" FT misc_feature 624667..624732 FT /note="Signal peptide predicted for BPSS0457 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.999 between residues 22 and 23" FT /colour=3 FT CDS 625073..625453 FT /note="Similar to Yersinia pestis putative copper FT resistance protein ypo1784 SWALL:Q8ZFD0 (EMBL:AJ414150) FT (128 aa) fasta scores: E(): 5e-10, 40.51% id in 116 aa, FT and to Escherichia coli copper resistance protein C FT precursor PcoC SWALL:PCOC_ECOLI (SWALL:Q47454) (126 aa) FT fasta scores: E(): 6.1e-05, 34.86% id in 109 aa" FT /locus_tag="BPSS0458" FT /class="1.4.2" FT /colour=0 FT /product="putative copper-resistance exported protein" FT misc_feature 625073..625159 FT /note="Signal peptide predicted for BPSS0458 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.698 between residues 32 and 33" FT /colour=3 FT misc_feature 625112..625153 FT /colour=8 FT /note="PS00099 Thiolases active site." FT CDS 625453..626397 FT /note="Similar to Ralstonia solanacearum probable copper FT resistance D transmembrane protein CopD or rsp0659 or FT rs01790 SWALL:Q8XS22 (EMBL:AL646080) (309 aa) fasta FT scores: E(): 2.3e-08, 30.88% id in 327 aa, and to FT Pseudomonas syringae copper resistance protein D copD FT SWALL:COPD_PSESF (SWALL:Q9KWM8) (311 aa) fasta scores: FT E(): 2.6e-08, 31.29% id in 262 aa" FT /locus_tag="BPSS0459" FT /class="1.4.2" FT /colour=0 FT /product="putative copper-resistance membrane protein" FT misc_feature order(625477..625545,625606..625674,625738..625797,625816..625869,625927..625995,626032..626100,626143..626211,626302..626370) FT /colour=0 FT /note="8 probable transmembrane helices predicted for FT BPSS0459 by TMHMM2.0 at aa 10-32, 53-75, 97-116, 123-140, FT 160-182, 195-217, 232-254 and 285-307" FT CDS 626698..628539 FT /note="Similar to Salmonella typhimurium methyl-accepting FT chemotaxis citrate transducer Tcp or stm3577 FT SWALL:MCPC_SALTY (SWALL:Q02755) (547 aa) fasta scores: FT E(): 1e-49, 43.19% id in 558 aa, and to Ralstonia FT solanacearum probable methyl-accepting chemotaxis I CheD3 FT or rsp1406 or rs02052 SWALL:Q8XQ80 (EMBL:AL646084) (608 FT aa) fasta scores: E(): 1e-57, 44.6% id in 621 aa" FT /locus_tag="BPSS0460" FT /class="1.1.1" FT /colour=0 FT /product="putative methyl-accepting chemotaxis protein" FT misc_feature order(626728..626796,627262..627330) FT /colour=0 FT /note="2 probable transmembrane helices predicted for FT BPSS0460 by TMHMM2.0 at aa 30-52 and 208-230" FT misc_feature 627274..627483 FT /note="Pfam match to entry PF00672 HAMP, HAMP domain , FT score 44.5, E-value 1.5e-10" FT /colour=9 FT misc_feature 627544..628242 FT /note="Pfam match to entry PF00015 MCPsignal, FT Methyl-accepting chemotaxis protein (MCP) signaling domain FT , score 352.5, E-value 3e-103" FT /colour=9 FT CDS complement(628847..630139) FT /note="Similar to Escherichia coli probable oxidoreductase FT OrdL or b1301 SWALL:ORDL_ECOLI (SWALL:P37906) (426 aa) FT fasta scores: E(): 4.4e-61, 43.97% id in 423 aa, and to FT Pseudomonas aeruginosa probable oxidoreductase pa5309 FT SWALL:Q9HTP5 (EMBL:AE004943) (439 aa) fasta scores: E(): FT 2e-73, 50% id in 436 aa" FT /locus_tag="BPSS0461" FT /class="7.0.0" FT /colour=13 FT /product="putative oxidoreductase" FT misc_feature complement(628973..630043) FT /note="Pfam match to entry PF01266 DAO, FAD dependent FT oxidoreductase , score -72.7, E-value 0.00041" FT /colour=9 FT misc_feature complement(629000..629032) FT /colour=8 FT /note="PS00639 Eukaryotic thiol (cysteine) proteases FT histidine active site." FT CDS complement(630210..631541) FT /note="Similar to Pseudomonas putida oxidoreductase, FT putative pp5273 SWALL:AAN70838 (EMBL:AE016793) (430 aa) FT fasta scores: E(): 5e-58, 42.51% id in 421 aa, and to FT Escherichia coli probable oxidoreductase OrdL or b1301 FT SWALL:ORDL_ECOLI (SWALL:P37906) (426 aa) fasta scores: FT E(): 1.7e-53, 38.42% id in 419 aa. Note: This CDS contains FT two possible alternative start codons at residues 5 and/or FT 14" FT /locus_tag="BPSS0462" FT /class="7.0.0" FT /colour=13 FT /product="putative oxidoreductase" FT misc_feature complement(630327..631406) FT /note="Pfam match to entry PF01266 DAO, FAD dependent FT oxidoreductase , score -77.5, E-value 0.00073" FT /colour=9 FT misc_feature complement(630366..630398) FT /colour=8 FT /note="PS00639 Eukaryotic thiol (cysteine) proteases FT histidine active site." FT CDS complement(631645..633219) FT /locus_tag="BPSS0463" FT /class="4.1.0" FT /colour=3 FT /note="No significant database matches" FT /product="putative exported protein" FT misc_feature complement(633160..633219) FT /note="Signal peptide predicted for BPSS0463 by SignalP FT 2.0 HMM (Signal peptide probability 1.000) with cleavage FT site probability 0.859 between residues 20 and 21" FT /colour=3 FT CDS complement(633288..634217) FT /note="Similar to Escherichia coli, and Escherichia coli FT O6 putrescine transport system permease protein PotI or FT b0857 or c0990 SWALL:POTI_ECOLI (SWALL:P31136) (281 aa) FT fasta scores: E(): 2.4e-56, 58.86% id in 265 aa, and to FT Salmonella typhi putrescine transport system permease FT protein sty0913 SWALL:Q8Z843 (EMBL:AL627268) (281 aa) FT fasta scores: E(): 4.5e-55, 57.35% id in 265 aa. Note: FT This CDS is longer in its C-terminal region than most of FT its database matches" FT /product="putrescine transport system permease protein" FT /gene="potI" FT /locus_tag="BPSS0464" FT /class="1.5.5" FT /colour=3 FT misc_feature complement(order(633429..633497,633525..633593,633612..633680,633738..633806,633843..633911,633954..634022,634122..634190)) FT /colour=0 FT /note="7 probable transmembrane helices predicted for FT BPSS0464 by TMHMM2.0 at aa 10-32, 66-88, 103-125, 138-160, FT 180-202, 209-231 and 241-263" FT misc_feature complement(633522..633743) FT /note="Pfam match to entry PF00528 BPD_transp, FT Binding-protein-dependent transport systems inner membrane FT component , score 42.7, E-value 5.3e-10" FT /colour=9 FT misc_feature complement(633654..633740) FT /colour=8 FT /note="PS00402 Binding-protein-dependent transport systems FT inner membrane comp. sign." FT misc_feature complement(634125..634217) FT /note="Signal peptide predicted for BPSS0464 by SignalP FT 2.0 HMM (Signal peptide probability 0.913) with cleavage FT site probability 0.588 between residues 31 and 32" FT /colour=3 FT CDS complement(634214..635194) FT /note="Similar to Escherichia coli putrescine transport FT system permease protein PotH or b0856 SWALL:POTH_ECOLI FT (SWALL:P31135) (317 aa) fasta scores: E(): 8.1e-65, 55.98% FT id in 284 aa, and to Yersinia pestis putrescine transport FT system permease protein ypo1333 or y2848 SWALL:AAM86399 FT (EMBL:AJ414147) (321 aa) fasta scores: E(): 4.5e-67, FT 53.72% id in 322 aa. Note: This CDS has a possible FT aternative star codon at residue 44" FT /product="putrescine ABC transport system, permease FT protein" FT /gene="potH" FT /locus_tag="BPSS0465" FT /class="1.5.5" FT /colour=3 FT misc_feature complement(order(634244..634312,634391..634450,634544..634612,634700..634768,634787..634855,635012..635080)) FT /colour=0 FT /note="6 probable transmembrane helices predicted for FT BPSS0465 by TMHMM2.0 at aa 39-61, 114-136, 143-165, FT 195-217, 249-268 and 295-317" FT misc_feature complement(634331..634552) FT /note="Pfam match to entry PF00528 BPD_transp, FT Binding-protein-dependent transport systems inner membrane FT component , score 62.9, E-value 4.6e-16" FT /colour=9 FT misc_feature complement(634463..634549) FT /colour=8 FT /note="PS00402 Binding-protein-dependent transport systems FT inner membrane comp. sign." FT misc_feature complement(635132..635194) FT /note="Signal peptide predicted for BPSS0465 by SignalP FT 2.0 HMM (Signal peptide probability 0.999) with cleavage FT site probability 0.484 between residues 21 and 22" FT /colour=3 FT CDS complement(635191..636345) FT /note="Similar to Escherichia coli putrescine transport FT ATP-binding protein PotG or b0855 SWALL:POTG_ECOLI FT (SWALL:P31134) (377 aa) fasta scores: E(): 1.4e-71, 54.83% FT id in 372 aa, and to Neisseria meningitidis FT spermidine/putrescine ABC transporter, ATP-binding protein FT nmb0610 SWALL:Q9K0I9 (EMBL:AE002416) (419 aa) fasta FT scores: E(): 1.4e-76, 56.38% id in 360 aa" FT /product="putrescine ABC transport system, ATP-binding FT protein" FT /gene="potG" FT /locus_tag="BPSS0466" FT /class="1.5.5" FT /colour=3 FT misc_feature complement(635647..636192) FT /note="Pfam match to entry PF00005 ABC_tran, ABC FT transporter , score 228.8, E-value 5e-66" FT /colour=9 FT misc_feature complement(635833..635877) FT /colour=8 FT /note="PS00211 ABC transporters family signature." FT misc_feature complement(636148..636171) FT /colour=8 FT /note="PS00017 ATP/GTP-binding site motif A (P-loop)." FT CDS complement(636535..637656) FT /note="Similar to Escherichia coli putrescine-binding FT periplasmic protein precursor PotF or b0854 FT SWALL:POTF_ECOLI (SWALL:P31133) (370 aa) fasta scores: FT E(): 3.3e-67, 49.3% id in 357 aa, and to Pseudomonas FT aeruginosa polyamine transport protein pa0301 SWALL:Q9I6J0 FT (EMBL:AE004468) (365 aa) fasta scores: E(): 6.3e-69, FT 49.59% id in 367 aa. Possible alternative translational FT start site" FT /product="putrescine ABC transport system, binding FT exported protein" FT /gene="potF" FT /locus_tag="BPSS0467" FT /class="1.5.5" FT /colour=3 FT misc_feature complement(636544..637548) FT /note="Pfam match to entry PF01547 SBP_bac_1, Bacterial FT extracellular solute-binding protein , score 86.5, E-value FT 3.6e-23" FT /colour=9 FT misc_feature complement(637564..637755) FT /note="Signal peptide predicted for BPSS0467 by SignalP FT 2.0 HMM (Signal peptide probability 0.961) with cleavage FT site probability 0.948 between residues 64 and 65" FT /colour=3 FT CDS complement(637724..639142) FT /note="Similar to Pseudomonas fluorescens BioA FT SWALL:Q9AH00 (EMBL:AF323694) (453 aa) fasta scores: E(): FT 1.1e-109, 58.29% id in 446 aa, and to Agrobacterium FT tumefaciens adenosylmethionine-8-amino-7-oxononanoate FT aminotransferase BioA or atu1002 or agr_c_1843 FT SWALL:Q8UGN4 (EMBL:AE009065) (484 aa) fasta scores: E(): FT 3.3e-101, 54.56% id in 438 aa" FT /locus_tag="BPSS0468" FT /class="7.0.0" FT /colour=13 FT /product="putative aminotransferase" FT misc_feature complement(637745..639031) FT /note="Pfam match to entry PF00202 aminotran_3, FT Aminotransferase class-III , score 341.2, E-value FT 7.5e-100" FT /colour=9 FT misc_feature complement(638216..638329) FT /colour=8 FT /note="PS00600 Aminotransferases class-III FT pyridoxal-phosphate attachment site." FT CDS complement(639178..640512) FT /note="Similar to Xanthomonas campestris glutamine FT synthetase GlnA or xcc2346 SWALL:AAM41624 (EMBL:AE012342) FT (461 aa) fasta scores: E(): 6e-107, 58.63% id in 440 aa, FT and to Thermotoga maritima glutamine synthetase GlnA or FT tm0943 SWALL:GLNA_THEMA (SWALL:P36205) (439 aa) fasta FT scores: E(): 1.9e-29, 28.09% id in 420 aa" FT /locus_tag="BPSS0469" FT /class="3.1.8" FT /colour=7 FT /product="putative glutamine synthetase" FT misc_feature complement(639412..640194) FT /note="Pfam match to entry PF00120 gln-synt, Glutamine FT synthetase, catalytic domain , score 367.0, E-value FT 1.3e-107" FT /colour=9 FT misc_feature complement(640207..640308) FT /note="Pfam match to entry PF03951 gln-synt_N, Glutamine FT synthetase, beta-Grasp domain , score 12.5, E-value FT 0.0013" FT /colour=9 FT CDS complement(640539..641339) FT /note="Similar to Pseudomonas aeruginosa probable FT glutamine amidotransferase pa0297 SWALL:Q9I6J4 FT (EMBL:AE004467) (250 aa) fasta scores: E(): 1.6e-48, FT 55.46% id in 247 aa, and to Escherichia coli O157:H7 FT probable amidotransferase subunit YcjL or z2490 or ecs1875 FT SWALL:Q8X7G2 (EMBL:AE005376) (258 aa) fasta scores: E(): FT 2e-31, 40.87% id in 252 aa" FT /locus_tag="BPSS0470" FT /class="3.1.8" FT /colour=7 FT /product="putative glutamine amidotransferase" FT CDS 641574..641981 FT /locus_tag="BPSS0471" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS 642281..642832 FT /note="Similar to Brucella melitensis transcriptional FT regulator, MerR family bmeii0372 SWALL:Q8YD05 FT (EMBL:AE009674) (182 aa) fasta scores: E(): 4.6e-32, FT 49.73% id in 185 aa, and to Shewanella oneidensis FT transcriptional regulator, putative so1265 SWALL:AAN54333 FT (EMBL:AE015570) (182 aa) fasta scores: E(): 2.1e-31, FT 53.29% id in 182 aa" FT /locus_tag="BPSS0472" FT /class="6.3.12" FT /colour=9 FT /product="putative MerR-family transcriptional regulator" FT misc_feature 642305..642469 FT /note="Pfam match to entry PF01381 HTH_3, Helix-turn-helix FT , score 53.9, E-value 2.2e-13" FT /colour=9 FT misc_feature 642332..642397 FT /note="Predicted helix-turn-helix motif with score FT 1970.000, SD 5.90 at aa 24-45, sequence FT LSQRELAKRAGVTNGTISLIEQ" FT /colour=2 FT CDS 642950..644440 FT /note="Similar to Escherichia coli putative aldehyde FT dehydrogenase AldH or b1300 SWALL:DHAL_ECOLI FT (SWALL:P23883) (495 aa) fasta scores: E(): 8.7e-104, FT 54.52% id in 497 aa, and to Pseudomonas aeruginosa FT probable aldehyde dehydrogenase pa5312 SWALL:Q9HTP2 FT (EMBL:AE004944) (497 aa) fasta scores: E(): 5.9e-121, FT 62.65% id in 498 aa" FT /locus_tag="BPSS0473" FT /class="3.3.21" FT /colour=7 FT /product="putative aldehyde dehydrogenase" FT misc_feature 643028..644434 FT /note="Pfam match to entry PF00171 aldedh, Aldehyde FT dehydrogenase family , score 751.7, E-value 2e-223" FT /colour=9 FT misc_feature 643742..643765 FT /colour=8 FT /note="PS00687 Aldehyde dehydrogenases glutamic acid FT active site." FT misc_feature 643829..643864 FT /colour=8 FT /note="PS00070 Aldehyde dehydrogenases cysteine active FT site." FT CDS 644571..645533 FT /note="Similar to Escherichia coli, Escherichia coli FT O157:H7, and Shigella flexneri agmatinase SpeB or b2937 or FT z4281 or ecs3812 or sf2927 SWALL:SPEB_ECOLI (SWALL:P16936) FT (306 aa) fasta scores: E(): 3e-50, 48.03% id in 306 aa, FT and to Rhizobium loti agmatinase mll8453 SWALL:Q982X2 FT (EMBL:AP003014) (335 aa) fasta scores: E(): 1.9e-57, FT 52.42% id in 309 aa" FT /product="agmatinase" FT /EC_number="3.5.3.11" FT /gene="speB" FT /locus_tag="BPSS0474" FT /class="3.3.14" FT /colour=7 FT misc_feature 644691..645509 FT /note="Pfam match to entry PF00491 arginase, Arginase FT family , score 240.2, E-value 2e-69" FT /colour=9 FT misc_feature 644961..645002 FT /colour=8 FT /note="PS00147 Arginase family signature 1." FT misc_feature 645033..645059 FT /colour=8 FT /note="PS00148 Arginase family signature 2." FT misc_feature 645288..645353 FT /colour=8 FT /note="PS01053 Arginase family signature 3." FT CDS 645652..646065 FT /locus_tag="BPSS0475" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS 646259..646549 FT /note="Similar to Bordetella pertussis 10 kDa chaperonin FT GroS or GroES or cpn10 SWALL:CH10_BORPE (SWALL:P48221) (95 FT aa) fasta scores: E(): 3.3e-24, 74.73% id in 95 aa, and to FT Neisseria gonorrhoeae 10 kDa chaperonin GroS or GroES FT SWALL:CH10_NEIGO (SWALL:P77913) (96 aa) fasta scores: E(): FT 2e-20, 63.83% id in 94 aa" FT /product="10 kDa chaperonin" FT /gene="groS" FT /gene="groES" FT /locus_tag="BPSS0476" FT /class="1.3.1" FT /colour=0 FT misc_feature 646259..646543 FT /note="Pfam match to entry PF00166 cpn10, Chaperonin 10 Kd FT subunit , score 209.4, E-value 3.5e-60" FT /colour=9 FT misc_feature 646265..646339 FT /colour=8 FT /note="PS00681 Chaperonins cpn10 signature." FT CDS 646571..648211 FT /note="Similar to Bordetella pertussis 60 kDa chaperonin FT GroL or GroEL or MopA or Cpn60 SWALL:CH60_BORPE FT (SWALL:P48210) (547 aa) fasta scores: E(): 9.5e-142, 79.7% FT id in 547 aa, and to Burkholderia thailandensis 60 kDa FT chaperonin GroL or GroEL SWALL:CH60_BURTH (SWALL:P58723) FT (546 aa) fasta scores: E(): 1.4e-149, 84.46% id in 547 aa" FT /product="60 kDa chaperonin" FT /gene="groL" FT /gene="groEL" FT /gene="mopA" FT /gene="cpn60" FT /locus_tag="BPSS0477" FT /class="1.3.1" FT /colour=0 FT misc_feature 646637..648145 FT /note="Pfam match to entry PF00118 cpn60_TCP1, TCP-1/cpn60 FT chaperonin family , score 671.3, E-value 3.2e-199" FT /colour=9 FT misc_feature 647783..647818 FT /colour=8 FT /note="PS00296 Chaperonins cpn60 signature." FT CDS complement(648273..648719) FT /note="Similar to Pseudomonas aeruginosa hypothetical FT protein pa2757 SWALL:Q9I086 (EMBL:AE004703) (147 aa) fasta FT scores: E(): 3.2e-30, 55.47% id in 146 aa, and to FT Vitreoscilla sp. hypothetical 17.2 kDa protein FT SWALL:Q9XD48 (EMBL:AF114793) (152 aa) fasta scores: E(): FT 6.4e-21, 45.32% id in 139 aa" FT /locus_tag="BPSS0478" FT /class="4.1.1" FT /colour=3 FT /product="putative membrane protein" FT misc_feature complement(order(648342..648410,648423..648491,648552..648620,648633..648701)) FT /colour=0 FT /note="4 probable transmembrane helices predicted for FT BPSS0478 by TMHMM2.0 at aa 7-29, 34-56, 77-99 and 104-126" FT CDS 649327..651861 FT /note="Similar to Vaccinia virus FT ribonucleoside-diphosphate reductase large chain I4L FT SWALL:RIR1_VACCV (SWALL:P12848) (771 aa) fasta scores: FT E(): 2.8e-22, 25.22% id in 654 aa, and to FT Thermoanaerobacter tengcongensis ribonucleotide reductase FT alpha subunit tte2336 SWALL:Q8R7R2 (EMBL:AE013176) (691 FT aa) fasta scores: E(): 9.2e-56, 36.48% id in 677 aa" FT /locus_tag="BPSS0479" FT /class="2.2.3" FT /colour=2 FT /product="putative ribonucleotide reductase protein" FT misc_feature 649579..651087 FT /note="Pfam match to entry PF02867 ribonuc_red_lgC, FT Ribonucleotide reductase, barrel domain , score 56.3, FT E-value 1.9e-15" FT /colour=9 FT CDS 652422..652544 FT /locus_tag="BPSS0480" FT /class="0.0.0" FT /colour=8 FT /note="No significant database matches" FT /product="hypothetical protein" FT CDS 652895..654520 FT /note="Similar to Azoarcus evansii 2-aminobenzoate-CoA FT ligase SWALL:Q93FC0 (EMBL:AF320253) (542 aa) fasta scores: FT E(): 2.6e-119, 57.35% id in 537 aa, and to Bacillus FT subtilis long-chain-fatty-acid--CoA ligase LcfA FT SWALL:LCFA_BACSU (SWALL:P94547) (560 aa) fasta scores: FT E(): 1.9e-31, 29.07% id in 564 aa" FT /locus_tag="BPSS0481" FT /class="3.2.10" FT /colour=7 FT /product="putative CoA ligase" FT misc_feature 653078..654277 FT /note="Pfam match to entry PF00501 AMP-binding, FT AMP-binding enzyme , score 327.2, E-value 1.2e-95" FT /colour=9 FT misc_feature order(653186..653254,653618..653686) FT /colour=0 FT /note="2 probable transmembrane helices predicted for FT BPSS0481 by TMHMM2.0 at aa 98-120 and 242-264" FT misc_feature 653477..653512 FT /colour=8 FT /note="PS00455 Putative AMP-binding domain signature." FT CDS 654607..655497 FT /note="Similar in its N-terminal region to Pseudomonas FT aeruginosa hypothetical protein pa0997 SWALL:Q9I4X2 FT (EMBL:AE004532) (283 aa) fasta scores: E(): 2.6e-08, FT 33.15% id in 190 aa and very low similarity also in its FT N-terminal region to Bacillus subtilis FT 3-oxoacyl-[acyl-carrier-protein] synthase III FabH FT SWALL:FABH_BACSU (SWALL:O34746) (312 aa) fasta scores: FT E(): 0.25, 27.27% id in 154 aa" FT /locus_tag="BPSS0482" FT /class="4.1.0" FT /colour=3 FT /product="putative exported protein" FT misc_feature 654607..654657 FT /note="Signal peptide predicted for BPSS0482 by SignalP FT 2.0 HMM (Signal peptide probability 0.989) with cleavage FT